(data stored in ACNUC7421 zone)

EMBL: CP000529.PE590

CP000529.PE590       Location/Qualifiers
FT   CDS             630162..631676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0598"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sco:SCO5857 FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35917"
FT                   /db_xref="GOA:A1VJT9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT9"
FT                   /protein_id="ABM35917.1"
FT                   /translation="MDMYNENENQWTNWAGSITTLPDTFCQPKSVRELQDIVIQNEGSI
FT                   IRCFGSGHSWTPLVVTNGGILIDPTGITENGQKAFRWQKNGLNLVTCFPSARWADVREA
FT                   LTTDGPLPKMYLPTAGVLPSINATGFVAAGCHGTGWEQPTVSDLIQAIEFVAADGKVHV
FT                   FSEDTTPNEMNTVRVSVGMLGVITKVTLKVDPMYRLWDQERLVPTAEVMGANPESRGGA
FT                   IDSSKLHALVTGNEYVELFWFPGSGFDGSIWVKQYNRTQDDPRDIPLRTDDDWVDSMAG
FT                   PVMQWSAQQPMVIPAVQALTWKTINDRVKVIESNKGFVADAPRVLHYQLKAFPILDLEV
FT                   AMPIPATGPNAWDFSNVVKAWWQAVNYTRVKWAAGKYPLTTCLHARFTKNSQALLSPAF
FT                   EPAHSETHYCWIEILSAYPKNDPNPNNRSAAMSEFDEMANRVVGEYWIKELKGRPHWSK
FT                   YWHKISPPVNIKSLLPQANLDTFNSLRRSLDPQDIFLNPFLRKQML"
     MDMYNENENQ WTNWAGSITT LPDTFCQPKS VRELQDIVIQ NEGSIIRCFG SGHSWTPLVV        60
     TNGGILIDPT GITENGQKAF RWQKNGLNLV TCFPSARWAD VREALTTDGP LPKMYLPTAG       120
     VLPSINATGF VAAGCHGTGW EQPTVSDLIQ AIEFVAADGK VHVFSEDTTP NEMNTVRVSV       180
     GMLGVITKVT LKVDPMYRLW DQERLVPTAE VMGANPESRG GAIDSSKLHA LVTGNEYVEL       240
     FWFPGSGFDG SIWVKQYNRT QDDPRDIPLR TDDDWVDSMA GPVMQWSAQQ PMVIPAVQAL       300
     TWKTINDRVK VIESNKGFVA DAPRVLHYQL KAFPILDLEV AMPIPATGPN AWDFSNVVKA       360
     WWQAVNYTRV KWAAGKYPLT TCLHARFTKN SQALLSPAFE PAHSETHYCW IEILSAYPKN       420
     DPNPNNRSAA MSEFDEMANR VVGEYWIKEL KGRPHWSKYW HKISPPVNIK SLLPQANLDT       480
     FNSLRRSLDP QDIFLNPFLR KQML                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page