(data stored in ACNUC7421 zone)

EMBL: CP000529.PE591

CP000529.PE591       Location/Qualifiers
FT   CDS             complement(631708..632685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0599"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35918"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU0"
FT                   /protein_id="ABM35918.1"
FT                   /translation="MRNLLNAPAIIAAALAFTFATAHAADAYPSKPIRMVVAFAAGGSA
FT                   DINARIVGQQLGKELGGTIVVDNKGGAGGNLGAVEVKRAAPDGYTFFYATSAVVLAPSL
FT                   YSKPGFDPYSDFTPVSLTATIPLVLVVNPNVPAKTVAELVAYGKANPNRLNYGSSGAGA
FT                   LLHLGGALFTKETGIQATHVAYKGSAPAVVDLLGGVTQFMFLPINEVMTHIKGGTLRAL
FT                   AVTNDKRSALLPDVPTLREATGKTTMDMGAWQGLMLPKGTPADVLGKVKAALENSLKDK
FT                   AMRDRLTAQGSIVLGGTQKEYADYMKQEGDRWARVIRDTGAKAD"
     MRNLLNAPAI IAAALAFTFA TAHAADAYPS KPIRMVVAFA AGGSADINAR IVGQQLGKEL        60
     GGTIVVDNKG GAGGNLGAVE VKRAAPDGYT FFYATSAVVL APSLYSKPGF DPYSDFTPVS       120
     LTATIPLVLV VNPNVPAKTV AELVAYGKAN PNRLNYGSSG AGALLHLGGA LFTKETGIQA       180
     THVAYKGSAP AVVDLLGGVT QFMFLPINEV MTHIKGGTLR ALAVTNDKRS ALLPDVPTLR       240
     EATGKTTMDM GAWQGLMLPK GTPADVLGKV KAALENSLKD KAMRDRLTAQ GSIVLGGTQK       300
     EYADYMKQEG DRWARVIRDT GAKAD                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page