(data stored in ACNUC7421 zone)

EMBL: CP000529.PE593

CP000529.PE593       Location/Qualifiers
FT   CDS             complement(633394..634260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0601"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: nar:Saro_2815 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35920"
FT                   /db_xref="GOA:A1VJU2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU2"
FT                   /protein_id="ABM35920.1"
FT                   /translation="MHIAIIGLGEVGRCYAAPLQAAGFELSLCEARPSPAATALASSLG
FT                   LPIHDKPGPWLAGAQWVLSCVTGAVALEVVKGLAPLLARGAAIADLTTASPQAKRDAAL
FT                   AASGHDVGYVDTAIMGAISLNLVRTPLLASGKGAEEFKELIERAGGRVQVIAGGAAGDA
FT                   ISLKILRSVFTKGMEALCVELLMSAEKQGVREQLYEQLSDIDQTPLRSFIDMLVRTHVI
FT                   HAGRRAHEVHDAQSELASQGLASVVLPGVEQRFRITASALEKHPLALAEPSIDQALQWL
FT                   ASTADQA"
     MHIAIIGLGE VGRCYAAPLQ AAGFELSLCE ARPSPAATAL ASSLGLPIHD KPGPWLAGAQ        60
     WVLSCVTGAV ALEVVKGLAP LLARGAAIAD LTTASPQAKR DAALAASGHD VGYVDTAIMG       120
     AISLNLVRTP LLASGKGAEE FKELIERAGG RVQVIAGGAA GDAISLKILR SVFTKGMEAL       180
     CVELLMSAEK QGVREQLYEQ LSDIDQTPLR SFIDMLVRTH VIHAGRRAHE VHDAQSELAS       240
     QGLASVVLPG VEQRFRITAS ALEKHPLALA EPSIDQALQW LASTADQA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page