(data stored in ACNUC7421 zone)

EMBL: CP000529.PE596

CP000529.PE596       Location/Qualifiers
FT   CDS             complement(635771..636760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0604"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_3116 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35923"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU5"
FT                   /protein_id="ABM35923.1"
FT                   /translation="MNHRRHFIQTLGSAAALAALSPLVARAQGLEQVKILYGFPPGSAG
FT                   DSVARRVGEKLAGSAYTKNAAVVENKPGAGGRIALETLKSAPADGSVLALAPVSGLSVY
FT                   PHIYSRLSYAPTDFAQVSIGAIMHHGLAVGPMVPAQVKTLKDFLAWAKANPAQASYGSP
FT                   GAGSMPHLLGALLGLRSGVDLKHVPYRGTVPGITDLVGGQIASTMNPSGDYLSYAKAGK
FT                   LRVLATSGPQRSPYSPNVPTFAEQGFGDLTVEEWFGFYAPAKTPAAVIASASAAINQAL
FT                   KEKVVLDSLAMVGLIAHGSTPEEMARSQKAEFERWGPLVKQTGFTAES"
     MNHRRHFIQT LGSAAALAAL SPLVARAQGL EQVKILYGFP PGSAGDSVAR RVGEKLAGSA        60
     YTKNAAVVEN KPGAGGRIAL ETLKSAPADG SVLALAPVSG LSVYPHIYSR LSYAPTDFAQ       120
     VSIGAIMHHG LAVGPMVPAQ VKTLKDFLAW AKANPAQASY GSPGAGSMPH LLGALLGLRS       180
     GVDLKHVPYR GTVPGITDLV GGQIASTMNP SGDYLSYAKA GKLRVLATSG PQRSPYSPNV       240
     PTFAEQGFGD LTVEEWFGFY APAKTPAAVI ASASAAINQA LKEKVVLDSL AMVGLIAHGS       300
     TPEEMARSQK AEFERWGPLV KQTGFTAES                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page