(data stored in ACNUC7421 zone)

EMBL: CP000529.PE600

CP000529.PE600       Location/Qualifiers
FT   CDS             640253..641245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35927"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU9"
FT                   /protein_id="ABM35927.1"
FT                   /translation="MKSHLAPRSLARLAGTAFVTLLAGHAMGQSPAVSQPGGLNLGNTS
FT                   FYDGFSGPPGWTWLSTVLHSSANKIVDSNGNASPVFTDPKINSTVFVNQITYAMPASIG
FT                   GWRPALMAILPVVALDTSFGPGPSLKDGGTGAGDITLEASLQAEPVMNAGGAPVFVQRL
FT                   AAAAILPTGRYDQNVDINQGSGYASFNPYWAASFFPAPRWETSWRLHYLYNFKNNKPAS
FT                   SAPRPFNGQPVSTTQAGDAAWVNFATSYSVTPDVSVGINGYFFQQLSDSRANGTRLADS
FT                   RERVLGIGPGMMWRISPKKALWINAYTESMVRNRAASPLSLQARMVINF"
     MKSHLAPRSL ARLAGTAFVT LLAGHAMGQS PAVSQPGGLN LGNTSFYDGF SGPPGWTWLS        60
     TVLHSSANKI VDSNGNASPV FTDPKINSTV FVNQITYAMP ASIGGWRPAL MAILPVVALD       120
     TSFGPGPSLK DGGTGAGDIT LEASLQAEPV MNAGGAPVFV QRLAAAAILP TGRYDQNVDI       180
     NQGSGYASFN PYWAASFFPA PRWETSWRLH YLYNFKNNKP ASSAPRPFNG QPVSTTQAGD       240
     AAWVNFATSY SVTPDVSVGI NGYFFQQLSD SRANGTRLAD SRERVLGIGP GMMWRISPKK       300
     ALWINAYTES MVRNRAASPL SLQARMVINF                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page