(data stored in ACNUC7421 zone)

EMBL: CP000529.PE64

CP000529.PE64        Location/Qualifiers
FT   CDS             68499..69125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0065"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pol:Bpro_0075 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35391"
FT                   /db_xref="GOA:A1VIB3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB3"
FT                   /protein_id="ABM35391.1"
FT                   /translation="MPGSFVGVADYGAFVVAILVFLAIPGPGNLALITSTGKGGIAGGM
FT                   GATLGVIAGDQVLLWAAVAGVSAVMAAYPAAFHVVQWLGAIYLAWLGLRMLLAKPGSAP
FT                   ILQIKPRHYFRQALLITLLNPKAIVFYLAFFPLFVDPAQHQGLKTFGVMAATIAVLTFL
FT                   YGLMAVLLTWKLAARLRANPKISATLEKAAGMFLIAFGIKLALSR"
     MPGSFVGVAD YGAFVVAILV FLAIPGPGNL ALITSTGKGG IAGGMGATLG VIAGDQVLLW        60
     AAVAGVSAVM AAYPAAFHVV QWLGAIYLAW LGLRMLLAKP GSAPILQIKP RHYFRQALLI       120
     TLLNPKAIVF YLAFFPLFVD PAQHQGLKTF GVMAATIAVL TFLYGLMAVL LTWKLAARLR       180
     ANPKISATLE KAAGMFLIAF GIKLALSR                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page