(data stored in ACNUC7421 zone)

EMBL: CP000529.PE67

CP000529.PE67        Location/Qualifiers
FT   CDS             70682..71617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0068"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: pol:Bpro_0078 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35394"
FT                   /db_xref="GOA:A1VIB6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB6"
FT                   /protein_id="ABM35394.1"
FT                   /translation="MVTKKQKGLGRGLEALLGPKVDESPEAANALIAASSPGLPASLLL
FT                   DDLVPGQYQPRTRMDEGALYELAESIKVQGIMQPILVRRLKSGSNSGKYEIIAGERRFR
FT                   AARLAGLDSLPVLIRDVPDESAAAMSLIENIQREDLNPLEEAQGLQRLVKEFGLTHELA
FT                   AQAVGRSRSAASNLLRLLNLADPVQTMLMAGDLDMGHARALLALDRATQITAANQITAK
FT                   KLSVREAESLVKKLGSEFSLTPNKAPPEKSRDTRRVEEELADLLMAEVQVRIKKQVKRN
FT                   GKREDVGELAIQFASLDEVNGLIERLRRTA"
     MVTKKQKGLG RGLEALLGPK VDESPEAANA LIAASSPGLP ASLLLDDLVP GQYQPRTRMD        60
     EGALYELAES IKVQGIMQPI LVRRLKSGSN SGKYEIIAGE RRFRAARLAG LDSLPVLIRD       120
     VPDESAAAMS LIENIQREDL NPLEEAQGLQ RLVKEFGLTH ELAAQAVGRS RSAASNLLRL       180
     LNLADPVQTM LMAGDLDMGH ARALLALDRA TQITAANQIT AKKLSVREAE SLVKKLGSEF       240
     SLTPNKAPPE KSRDTRRVEE ELADLLMAEV QVRIKKQVKR NGKREDVGEL AIQFASLDEV       300
     NGLIERLRRT A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page