(data stored in ACNUC7421 zone)

EMBL: CP000529.PE68

CP000529.PE68        Location/Qualifiers
FT   CDS             complement(71660..73081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0069"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0111 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35395"
FT                   /db_xref="GOA:A1VIB7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB7"
FT                   /protein_id="ABM35395.1"
FT                   /translation="MNAPLPKHLLPGILQRETPQALIAALKNRFAERCSTALVVREQHG
FT                   RDESSFAAPPPAAVVFAESTQDVADAVRLAGQYSVPVIPFGVGTSLEGHLLAVQGGISI
FT                   DVSRMNRVLAINPEDLTVTVQPGVTRRQLNEEIKSTGLFFPIDPGADATLGGMSATRAS
FT                   GTNAVRYGTMRENVLALEVVTASGEIIRTGTRAKKSAAGYDLTRLMVGSEGTLGVITEV
FT                   TVKLYPLPEAISAAVCSFPSIEAAVRTTIEIIQLGVPIARVELIDAHTVRMVNAHSRLA
FT                   LREEPMLLMEFHGTPNGVKEQAELVQELASGHGGNAFEWASTPEERTRLWTARHNAYFA
FT                   AIQSKPGCRAISTDTCVPISRLADCLLESVAEAEASGIPYFLVGHVGDGNFHFGYLIDP
FT                   DNAQERDAAEALNHQLVARALSLEGTCTGEHGIGLGKMDFLLSETGGGAVDMMRAIKRA
FT                   LDPQNIMNPGKIFTL"
     MNAPLPKHLL PGILQRETPQ ALIAALKNRF AERCSTALVV REQHGRDESS FAAPPPAAVV        60
     FAESTQDVAD AVRLAGQYSV PVIPFGVGTS LEGHLLAVQG GISIDVSRMN RVLAINPEDL       120
     TVTVQPGVTR RQLNEEIKST GLFFPIDPGA DATLGGMSAT RASGTNAVRY GTMRENVLAL       180
     EVVTASGEII RTGTRAKKSA AGYDLTRLMV GSEGTLGVIT EVTVKLYPLP EAISAAVCSF       240
     PSIEAAVRTT IEIIQLGVPI ARVELIDAHT VRMVNAHSRL ALREEPMLLM EFHGTPNGVK       300
     EQAELVQELA SGHGGNAFEW ASTPEERTRL WTARHNAYFA AIQSKPGCRA ISTDTCVPIS       360
     RLADCLLESV AEAEASGIPY FLVGHVGDGN FHFGYLIDPD NAQERDAAEA LNHQLVARAL       420
     SLEGTCTGEH GIGLGKMDFL LSETGGGAVD MMRAIKRALD PQNIMNPGKI FTL              473
//

If you have problems or comments...

PBIL Back to PBIL home page