(data stored in ACNUC7421 zone)

EMBL: CP000529.PE70

CP000529.PE70        Location/Qualifiers
FT   CDS             complement(73873..74817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0071"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bxe:Bxe_A2466 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35397"
FT                   /db_xref="GOA:A1VIB9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB9"
FT                   /protein_id="ABM35397.1"
FT                   /translation="MNFQQLRSVRETVRCGFNLTDVATALHTSQPGVSRQIRELEEEIG
FT                   IELFVRAGKRLTGLTEPGAHVLPIVERLLLECSNLKKAGQEYMAQQNGLLSIAATHSQA
FT                   RYALPPAVQEFRAQFPHVKLHLHQGSPKQVAEMLLSGEVDVGIATEALNGYPELVALPC
FT                   YRWTHSVIVPPGHALLSGPLTLERLAQFALITYDNGFTGRTHIDQAFAQHQLMPNIVLT
FT                   AMDADVIKTYVELGMGVGIVASIAYEAERDTALRALDAGALFGINLTKLAVRRGSYLRS
FT                   YVYAFIESFAPTLNRAIVEQTLSGAPGGDHYDI"
     MNFQQLRSVR ETVRCGFNLT DVATALHTSQ PGVSRQIREL EEEIGIELFV RAGKRLTGLT        60
     EPGAHVLPIV ERLLLECSNL KKAGQEYMAQ QNGLLSIAAT HSQARYALPP AVQEFRAQFP       120
     HVKLHLHQGS PKQVAEMLLS GEVDVGIATE ALNGYPELVA LPCYRWTHSV IVPPGHALLS       180
     GPLTLERLAQ FALITYDNGF TGRTHIDQAF AQHQLMPNIV LTAMDADVIK TYVELGMGVG       240
     IVASIAYEAE RDTALRALDA GALFGINLTK LAVRRGSYLR SYVYAFIESF APTLNRAIVE       300
     QTLSGAPGGD HYDI                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page