(data stored in ACNUC7421 zone)

EMBL: CP000529.PE73

CP000529.PE73        Location/Qualifiers
FT   CDS             77560..78861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35400"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC2"
FT                   /protein_id="ABM35400.1"
FT                   /translation="MTRTRQWLLGAGVAAGMLALLAALLLSLVPSDEELAARASAELEA
FT                   ALGVPVRVGALHWRLRPTPTVVIEEVATGQPQPIEIKRLTAHLNTSALWQRRMKVDLAV
FT                   VQGAVLPQLSLRGLGRKPAAAEAGPAREFTLDEVPMARIEFGDVTWISRHGIRVVYEGE
FT                   ADFDAAWRPRTARLRRPQTSPPADLALARKGQDDRWEVRSHIGGGTADGELLLHTSGQG
FT                   GLRLTGQLQPRHIEVASALQAFNRRAIIAGKASGETTLSASGATAGELARSLHTTTSFS
FT                   MGRSTLLRFDLDKAIRSLGQAHAGQTPLDSVTGQIDTQNTPQGMVVTFSRLQARSGAFS
FT                   ASGKARVAELRIQAELAVDLVDGVVGVPLTLSGPLDKVQVSVPASALAGAAAGTAVLPG
FT                   IGTAIGARIGAAIGKLFGSEPEPAAGPRPAPGKQ"
     MTRTRQWLLG AGVAAGMLAL LAALLLSLVP SDEELAARAS AELEAALGVP VRVGALHWRL        60
     RPTPTVVIEE VATGQPQPIE IKRLTAHLNT SALWQRRMKV DLAVVQGAVL PQLSLRGLGR       120
     KPAAAEAGPA REFTLDEVPM ARIEFGDVTW ISRHGIRVVY EGEADFDAAW RPRTARLRRP       180
     QTSPPADLAL ARKGQDDRWE VRSHIGGGTA DGELLLHTSG QGGLRLTGQL QPRHIEVASA       240
     LQAFNRRAII AGKASGETTL SASGATAGEL ARSLHTTTSF SMGRSTLLRF DLDKAIRSLG       300
     QAHAGQTPLD SVTGQIDTQN TPQGMVVTFS RLQARSGAFS ASGKARVAEL RIQAELAVDL       360
     VDGVVGVPLT LSGPLDKVQV SVPASALAGA AAGTAVLPGI GTAIGARIGA AIGKLFGSEP       420
     EPAAGPRPAP GKQ                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page