(data stored in ACNUC7421 zone)

EMBL: CP000529.PE76

CP000529.PE76        Location/Qualifiers
FT   CDS             complement(80771..81925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0077"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: lpp:lpp2271 twitching
FT                   motility protein PilU"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35403"
FT                   /db_xref="GOA:A1VIC5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC5"
FT                   /protein_id="ABM35403.1"
FT                   /translation="MPLPAQAAPSPSPSPSDPDDLGRYLALMVAHGASDLFLSAEVAAS
FT                   LKIQGRIRRLPEPPLTGTHIKRLAYSVMRDSQVREFEADLECDLAIAMDALGRFRVNVF
FT                   RQRGEVAVVVRHINSTIPTLESLKLPPVLKTLAMLKRGLVLVVGAAGSGKSTTLAAMLD
FT                   YRNNMASDHILTVEDPMEFEHSHKKCIVDQREVGLDTRSFDEALRRAMREAPDVIMIGE
FT                   IRDRETMQHAMAYAETGHLCVSTLHANNANQAIQRVLNFFPETAQRQVLMDLSLNLKGV
FT                   VGQRLLAGAAGKRVPAVEVMLLSPYVADLIQKGQTDEIKAVMAKSVELGMATFDQSLYE
FT                   LYVRGDITHEQAIEHADSKTDLSLRIRLASGRRPDTEALQVLRD"
     MPLPAQAAPS PSPSPSDPDD LGRYLALMVA HGASDLFLSA EVAASLKIQG RIRRLPEPPL        60
     TGTHIKRLAY SVMRDSQVRE FEADLECDLA IAMDALGRFR VNVFRQRGEV AVVVRHINST       120
     IPTLESLKLP PVLKTLAMLK RGLVLVVGAA GSGKSTTLAA MLDYRNNMAS DHILTVEDPM       180
     EFEHSHKKCI VDQREVGLDT RSFDEALRRA MREAPDVIMI GEIRDRETMQ HAMAYAETGH       240
     LCVSTLHANN ANQAIQRVLN FFPETAQRQV LMDLSLNLKG VVGQRLLAGA AGKRVPAVEV       300
     MLLSPYVADL IQKGQTDEIK AVMAKSVELG MATFDQSLYE LYVRGDITHE QAIEHADSKT       360
     DLSLRIRLAS GRRPDTEALQ VLRD                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page