(data stored in ACNUC7421 zone)

EMBL: CP000529.PE79

CP000529.PE79        Location/Qualifiers
FT   CDS             83455..84699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0080"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_3412 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35406"
FT                   /db_xref="GOA:A1VIC8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC8"
FT                   /protein_id="ABM35406.1"
FT                   /translation="MKPLFKWGVGALLVLAVAGAAVLASRRGTPVQLVPVARTGIVQSV
FT                   VATGRLNAPARMDIGAEVTATVLEVRVREGDRVRAGALLLRLSDAEARAALQQASAALV
FT                   EARGRATQQATVAAPVAGQAVVQAEAAFTSAERDFQRARELVAQGFFSQQKLDDARRAL
FT                   DTARSALQSARVQAQANQPSGVERTLAASRVDQALAAVDIAQARLARLSIASPVDAIVL
FT                   TRSVEPGSMAQPGHVLLTLAAQGGTRIDANVDEKNLRLLTPGMPAKAVADAYPGQSFDA
FT                   QLNYIAPAVDPQRGTVEVRLAVPNPPPFLRPDMTVSVELVGGLKKDALVLPSGAVRDAD
FT                   REAPWVLALQDGLAVRVPVKLGLRGVGSIEITEGLKEGDAIIPQTEKAIAGDRVRPGPV
FT                   VAPVKGMETPSFISR"
     MKPLFKWGVG ALLVLAVAGA AVLASRRGTP VQLVPVARTG IVQSVVATGR LNAPARMDIG        60
     AEVTATVLEV RVREGDRVRA GALLLRLSDA EARAALQQAS AALVEARGRA TQQATVAAPV       120
     AGQAVVQAEA AFTSAERDFQ RARELVAQGF FSQQKLDDAR RALDTARSAL QSARVQAQAN       180
     QPSGVERTLA ASRVDQALAA VDIAQARLAR LSIASPVDAI VLTRSVEPGS MAQPGHVLLT       240
     LAAQGGTRID ANVDEKNLRL LTPGMPAKAV ADAYPGQSFD AQLNYIAPAV DPQRGTVEVR       300
     LAVPNPPPFL RPDMTVSVEL VGGLKKDALV LPSGAVRDAD REAPWVLALQ DGLAVRVPVK       360
     LGLRGVGSIE ITEGLKEGDA IIPQTEKAIA GDRVRPGPVV APVKGMETPS FISR             414
//

If you have problems or comments...

PBIL Back to PBIL home page