(data stored in ACNUC7421 zone)

EMBL: CP000529.PE82

CP000529.PE82        Location/Qualifiers
FT   CDS             87552..87908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0084"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   eba:ebD100 hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35409"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID1"
FT                   /protein_id="ABM35409.1"
FT                   /translation="MVIKVEEYIREDSSNPYKHWFDGLPSQAAAKVTVAKLRMELGNTS
FT                   SIKWFDGMGEYVIDWGPGYRIYLAKEGDTLIVLFGGGTKRGQQRDIDKAKELLTEYKAR
FT                   KKAMTTKSTGKHKR"
     MVIKVEEYIR EDSSNPYKHW FDGLPSQAAA KVTVAKLRME LGNTSSIKWF DGMGEYVIDW        60
     GPGYRIYLAK EGDTLIVLFG GGTKRGQQRD IDKAKELLTE YKARKKAMTT KSTGKHKR         118
//

If you have problems or comments...

PBIL Back to PBIL home page