(data stored in ACNUC7421 zone)

EMBL: CP000529.PE87

CP000529.PE87        Location/Qualifiers
FT   CDS             complement(90501..92018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0089"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: rfr:Rfer_2024 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35414"
FT                   /db_xref="GOA:A1VID6"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID6"
FT                   /protein_id="ABM35414.1"
FT                   /translation="MKKHPLAPSPEEIELKLALPTSSPSGLAGLAKRLAQTPVLARRKA
FT                   TRQQLHNIYYDTPGQRLHQKRVALRLRRVGSDANPSWLQTLKMGGRSDSALSQRGEWEL
FT                   PVPGAELARQALEATPWSKFDPDGSVFKALAPCIVTTFERTSWSVRKRGGSVVEVSLDI
FT                   GQVVAGDRRTPICELELELLAGQPAALFDIARQIARSVAVLPLNASKAERGYALLQDAQ
FT                   SLPLRARPPALTRNMALPLAAQCVLREMFGQFTSNLNTLTRSDDPEVVHQARVGWRRFR
FT                   SAWRLFQPALAAHAAAPAWQSLEPLLMFVGELRDLDVALNDTLPPLAAAYTAGNAQREE
FT                   KWQAMLQALTQAALLQRKSVRHALQTPAVGATLLAITQWLEELPASKGPDDAKAGPDIS
FT                   LRRWARQRITRQHKKMKQALKDTAHPESQHRARILSKRLRYGIEALRPLLPRRQAERWH
FT                   AKATALQTGIGATRDIMQAGVLAVRFEADPGLAEFLRGVAAGQPVPR"
     MKKHPLAPSP EEIELKLALP TSSPSGLAGL AKRLAQTPVL ARRKATRQQL HNIYYDTPGQ        60
     RLHQKRVALR LRRVGSDANP SWLQTLKMGG RSDSALSQRG EWELPVPGAE LARQALEATP       120
     WSKFDPDGSV FKALAPCIVT TFERTSWSVR KRGGSVVEVS LDIGQVVAGD RRTPICELEL       180
     ELLAGQPAAL FDIARQIARS VAVLPLNASK AERGYALLQD AQSLPLRARP PALTRNMALP       240
     LAAQCVLREM FGQFTSNLNT LTRSDDPEVV HQARVGWRRF RSAWRLFQPA LAAHAAAPAW       300
     QSLEPLLMFV GELRDLDVAL NDTLPPLAAA YTAGNAQREE KWQAMLQALT QAALLQRKSV       360
     RHALQTPAVG ATLLAITQWL EELPASKGPD DAKAGPDISL RRWARQRITR QHKKMKQALK       420
     DTAHPESQHR ARILSKRLRY GIEALRPLLP RRQAERWHAK ATALQTGIGA TRDIMQAGVL       480
     AVRFEADPGL AEFLRGVAAG QPVPR                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page