(data stored in ACNUC7421 zone)

EMBL: CP000529.PE88

CP000529.PE88        Location/Qualifiers
FT   CDS             complement(92109..93173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0090"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rso:RSp1044 probable
FT                   cobalt-nickel-resistance system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35415"
FT                   /db_xref="GOA:A1VID7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID7"
FT                   /protein_id="ABM35415.1"
FT                   /translation="MSLRSAFPALASALLFGASTPLAKLLAGNMPPLLLAGLLYLGSGL
FT                   GLGMLLLLRRLRERLRGQPVTRLHIARAELPWLLGAIVAGGLLGPALFMLGLAQTSAAS
FT                   ASLLLNLEGMLTAVIAWLAFRENADRRIVLGMLAIALGGVLLSWEPGGATFSPGSLLIA
FT                   GACLCWALDNNLTRKVSANDALLLACLKGLLAGMGNTAIALYGGAVLPAAPALGYAGVV
FT                   GFLGYGLSLSLFVVALRTLGSARTGAYFSVAPLFGVLVSLAIWPDMPGLLFWTAAALMG
FT                   FGVWLHLSERHAHAHTHEPLRHSHAHRHDAHHRHAHDFAWDEKSPHAHEHQHEALTHSH
FT                   AHYPDIHHRHPHPH"
     MSLRSAFPAL ASALLFGAST PLAKLLAGNM PPLLLAGLLY LGSGLGLGML LLLRRLRERL        60
     RGQPVTRLHI ARAELPWLLG AIVAGGLLGP ALFMLGLAQT SAASASLLLN LEGMLTAVIA       120
     WLAFRENADR RIVLGMLAIA LGGVLLSWEP GGATFSPGSL LIAGACLCWA LDNNLTRKVS       180
     ANDALLLACL KGLLAGMGNT AIALYGGAVL PAAPALGYAG VVGFLGYGLS LSLFVVALRT       240
     LGSARTGAYF SVAPLFGVLV SLAIWPDMPG LLFWTAAALM GFGVWLHLSE RHAHAHTHEP       300
     LRHSHAHRHD AHHRHAHDFA WDEKSPHAHE HQHEALTHSH AHYPDIHHRH PHPH             354
//

If you have problems or comments...

PBIL Back to PBIL home page