(data stored in ACNUC7421 zone)

EMBL: CP000529.PE89

CP000529.PE89        Location/Qualifiers
FT   CDS             93497..96289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0091"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: ana:alr3092 two-component hybrid sensor and
FT                   regulator; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35416"
FT                   /db_xref="GOA:A1VID8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID8"
FT                   /protein_id="ABM35416.1"
FT                   /translation="MQTQMRAHDWSTSGLGSPASWPQPLKTVAGLMLHCRTPVFLAWGP
FT                   ELSLLYNDAYLDILGERHPAALGRPLYEAWAEIRAEIEPLVNQALSGEPVYFEDAVFTL
FT                   RRKGADEQAWFSFSYAPVDGPDGTVAGLYCNLTETTAKVLAEKNRQAETRRLYSLFEQA
FT                   PSFMAVVHGSSHVYELANSAYLRMAGCQDLVGKTFREAVQGIEDQGYVALLDQVYATGQ
FT                   PFIGNRMPVIFSRHADGPPEQCFVDFIFQPITAPDGVVNGIFIEGNDVTEQVRTEDDLR
FT                   KSRIAGLETAQQLNALLQAAPVAIVMADMHGKPLRFNPASRQLWGDHPASESIAGYAER
FT                   KGWWADGSVRHGCRLEAHEWALARALQGEEAPRDTVEIEPFGKPGIRRTILNCGAPVRN
FT                   LDGDIIGSVAAQMDISDRVAIEAALRETVTQYRTITNAIPQIVWATRPDGYHDYFNQQW
FT                   YDYTGVPQDSTVGEGWKGLFHLEDQLQAAKNWRHSLATGEPYEIEYRLRHHSGQYRWNL
FT                   GRALPVRNEQGAIVRWMGTCTDIHEQKLAQEGLLQADRLKDEFLAMLAHELRNPLAPIA
FT                   TAAHLLSTGTLDPEGLSRLSEVISRQAGHMTRLIDDLLDVSRVTWGQVTLDKNPLDMNS
FT                   IVTEAVEQVRPLLQAKSQHLDIQLSPQRNLVSGDRMRLVQVLANVLNNAVKYTPDGGRI
FT                   TLRVVEDDSHLTVCVRDNGIGMSRELLAIAFELFTQGERTSDRTQGGLGIGLALVQTLV
FT                   HLHGGTVRLHSEGAGLGSELTMVLPRLPQDDGPRRFDAGDALAVPARESLRVMVVDDNV
FT                   DAARLLGMFVELLGHEVFVQFHPASAIECAHQVQPDICLLDIGLPDMDGYTLARQLHRI
FT                   PGMENTVLAAVTGYSQPRDKQAAFAAGFNFHFAKPISAQQLESWLADVTRGRESLSASP
FT                   "
     MQTQMRAHDW STSGLGSPAS WPQPLKTVAG LMLHCRTPVF LAWGPELSLL YNDAYLDILG        60
     ERHPAALGRP LYEAWAEIRA EIEPLVNQAL SGEPVYFEDA VFTLRRKGAD EQAWFSFSYA       120
     PVDGPDGTVA GLYCNLTETT AKVLAEKNRQ AETRRLYSLF EQAPSFMAVV HGSSHVYELA       180
     NSAYLRMAGC QDLVGKTFRE AVQGIEDQGY VALLDQVYAT GQPFIGNRMP VIFSRHADGP       240
     PEQCFVDFIF QPITAPDGVV NGIFIEGNDV TEQVRTEDDL RKSRIAGLET AQQLNALLQA       300
     APVAIVMADM HGKPLRFNPA SRQLWGDHPA SESIAGYAER KGWWADGSVR HGCRLEAHEW       360
     ALARALQGEE APRDTVEIEP FGKPGIRRTI LNCGAPVRNL DGDIIGSVAA QMDISDRVAI       420
     EAALRETVTQ YRTITNAIPQ IVWATRPDGY HDYFNQQWYD YTGVPQDSTV GEGWKGLFHL       480
     EDQLQAAKNW RHSLATGEPY EIEYRLRHHS GQYRWNLGRA LPVRNEQGAI VRWMGTCTDI       540
     HEQKLAQEGL LQADRLKDEF LAMLAHELRN PLAPIATAAH LLSTGTLDPE GLSRLSEVIS       600
     RQAGHMTRLI DDLLDVSRVT WGQVTLDKNP LDMNSIVTEA VEQVRPLLQA KSQHLDIQLS       660
     PQRNLVSGDR MRLVQVLANV LNNAVKYTPD GGRITLRVVE DDSHLTVCVR DNGIGMSREL       720
     LAIAFELFTQ GERTSDRTQG GLGIGLALVQ TLVHLHGGTV RLHSEGAGLG SELTMVLPRL       780
     PQDDGPRRFD AGDALAVPAR ESLRVMVVDD NVDAARLLGM FVELLGHEVF VQFHPASAIE       840
     CAHQVQPDIC LLDIGLPDMD GYTLARQLHR IPGMENTVLA AVTGYSQPRD KQAAFAAGFN       900
     FHFAKPISAQ QLESWLADVT RGRESLSASP                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page