(data stored in ACNUC7421 zone)

EMBL: CP000529.PE9

CP000529.PE9         Location/Qualifiers
FT   CDS             8791..9030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0021 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35336"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI58"
FT                   /protein_id="ABM35336.1"
FT                   /translation="MHEDCAHLETLRTKRDIIPELDELPDPWILFVRLRQPFTAGLHKW
FT                   GALWVYTRRGTGYWGSPKRFGAPSEITCLRLVAA"
     MHEDCAHLET LRTKRDIIPE LDELPDPWIL FVRLRQPFTA GLHKWGALWV YTRRGTGYWG        60
     SPKRFGAPSE ITCLRLVAA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page