(data stored in ACNUC7421 zone)

EMBL: CP000529.PE90

CP000529.PE90        Location/Qualifiers
FT   CDS             complement(96335..96853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0092"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: pol:Bpro_0126 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35417"
FT                   /db_xref="GOA:A1VID9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID9"
FT                   /protein_id="ABM35417.1"
FT                   /translation="MSPLSPLRKASSPSFSPLEFRASLAMFATGVTIVTARTPAGVLVG
FT                   LTANSFNSVSLNPPLVLWSLSQAASSMAALSTGSHYAINILAADQKELAERFASRREDR
FT                   WTDVAFTEGIGGAPLLDGAAATFECFNRSRYEEGDHVIFVGEVERCSHRAGAAPLLFHG
FT                   GRFYTEHPL"
     MSPLSPLRKA SSPSFSPLEF RASLAMFATG VTIVTARTPA GVLVGLTANS FNSVSLNPPL        60
     VLWSLSQAAS SMAALSTGSH YAINILAADQ KELAERFASR REDRWTDVAF TEGIGGAPLL       120
     DGAAATFECF NRSRYEEGDH VIFVGEVERC SHRAGAAPLL FHGGRFYTEH PL               172
//

If you have problems or comments...

PBIL Back to PBIL home page