(data stored in ACNUC7421 zone)

EMBL: CP000529.PE93

CP000529.PE93        Location/Qualifiers
FT   CDS             98864..99778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0149 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35420"
FT                   /db_xref="GOA:A1VIE2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE2"
FT                   /protein_id="ABM35420.1"
FT                   /translation="MSTFDPDALECLAAIVEEGGFERAARRLSITQSAVSQRLRALEAQ
FT                   VGTVLIVRSRPLKATSAGQLLLKHTKMLRLLRADLERDLKELAPSSLRGAREDERISIA
FT                   INADSIATWALPALTGLAQQGLPMEIITDDQDFTHEWLRQGQVLGCVTTLKQALRGCKV
FT                   VPLGAMEYVAVATPALARERLGFDALTAHNFREIPFVAFNRKDDMQSEFVGKAFGLKRV
FT                   MLNQLFVPSSEGQVRAVLAGWGASVLPRLLAQERIDQGLLVNLAPACILPIQLYWHCWN
FT                   LESEVLDALTAALIQSAGLALVA"
     MSTFDPDALE CLAAIVEEGG FERAARRLSI TQSAVSQRLR ALEAQVGTVL IVRSRPLKAT        60
     SAGQLLLKHT KMLRLLRADL ERDLKELAPS SLRGAREDER ISIAINADSI ATWALPALTG       120
     LAQQGLPMEI ITDDQDFTHE WLRQGQVLGC VTTLKQALRG CKVVPLGAME YVAVATPALA       180
     RERLGFDALT AHNFREIPFV AFNRKDDMQS EFVGKAFGLK RVMLNQLFVP SSEGQVRAVL       240
     AGWGASVLPR LLAQERIDQG LLVNLAPACI LPIQLYWHCW NLESEVLDAL TAALIQSAGL       300
     ALVA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page