(data stored in ACNUC7421 zone)

EMBL: CP000529.PE96

CP000529.PE96        Location/Qualifiers
FT   CDS             complement(105043..105465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0098"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rfr:Rfer_0401 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35423"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE5"
FT                   /protein_id="ABM35423.1"
FT                   /translation="MKILLAVDGSSYTKKMLAYLVTHDALFDAKNEYAVLTVQPALPPH
FT                   ARAAVGKEIVDSYYAEETGKVMAPVAEFLKHHGIIAKSDWKVGPAGETIAKFADEGKFD
FT                   LLIMGSHGHGALGNLIMGSVTTQVLAHSKVPVLLVR"
     MKILLAVDGS SYTKKMLAYL VTHDALFDAK NEYAVLTVQP ALPPHARAAV GKEIVDSYYA        60
     EETGKVMAPV AEFLKHHGII AKSDWKVGPA GETIAKFADE GKFDLLIMGS HGHGALGNLI       120
     MGSVTTQVLA HSKVPVLLVR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page