(data stored in ACNUC30630 zone)

EMBL: CP000580.PE106

CP000580.PE106       Location/Qualifiers
FT   CDS             114084..114881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0106"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0116 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95919"
FT                   /protein_id="ABN95919.1"
FT                   /translation="MTASSGGLTGYVRDQVRPGLEAVGGFVRMCVLTGKALFRPFQWRE
FT                   FILQAWFLFRVSFLPTVAVSVPLTVLIIFTLNILLAEFGAADVSGAGAALGAVTQLGPL
FT                   VTVLVVAGAGSTAICADLGARTIREEIDALEVLGIDPIHRLVVPRVVASTFVALLLNGA
FT                   VITIGLVGGFIFGVYIQNVSAGAYVSTLTLVTGLPEVLISVVKATTFGLIAGLVGCYRG
FT                   LTVGGGAKGVGTGVNETLVLCVVALFAVNVVLTTIGVRFGTGR"
     MTASSGGLTG YVRDQVRPGL EAVGGFVRMC VLTGKALFRP FQWREFILQA WFLFRVSFLP        60
     TVAVSVPLTV LIIFTLNILL AEFGAADVSG AGAALGAVTQ LGPLVTVLVV AGAGSTAICA       120
     DLGARTIREE IDALEVLGID PIHRLVVPRV VASTFVALLL NGAVITIGLV GGFIFGVYIQ       180
     NVSAGAYVST LTLVTGLPEV LISVVKATTF GLIAGLVGCY RGLTVGGGAK GVGTGVNETL       240
     VLCVVALFAV NVVLTTIGVR FGTGR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page