(data stored in ACNUC30630 zone)

EMBL: CP000580.PE109

CP000580.PE109       Location/Qualifiers
FT   CDS             116996..118027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0109"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0119 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95922"
FT                   /protein_id="ABN95922.1"
FT                   /translation="MKITGTALKLGAFSLVLLLFTAIIIVVFGQMRFDRTTGYSAIFTN
FT                   VSGLRPGQFVRASGVEVGKVSKIELIEGGSRVKVDFKVDRSLPLFDESTASVRYLNLIG
FT                   DRYLELKRGDSDRKMPSGGTIPVERTEPALDLDALIGGFRPLFRALDPEKVNNIARSII
FT                   TVFQGQGGTINDILDQTASLTSALADRDQAIGEVIRNLNTVLDTTVRHQEQFDETLVNF
FT                   ERLITGLKNRADPIASSVADISDAAGTVADLLAENRSLLQDTVGYLEATQQPLVEQKGQ
FT                   LNDILVRLPNALKIIGRAGGVYGDFFNFYACDVTLKLNGLQPGGPVRTVKVWGQPTGRC
FT                   TPQ"
     MKITGTALKL GAFSLVLLLF TAIIIVVFGQ MRFDRTTGYS AIFTNVSGLR PGQFVRASGV        60
     EVGKVSKIEL IEGGSRVKVD FKVDRSLPLF DESTASVRYL NLIGDRYLEL KRGDSDRKMP       120
     SGGTIPVERT EPALDLDALI GGFRPLFRAL DPEKVNNIAR SIITVFQGQG GTINDILDQT       180
     ASLTSALADR DQAIGEVIRN LNTVLDTTVR HQEQFDETLV NFERLITGLK NRADPIASSV       240
     ADISDAAGTV ADLLAENRSL LQDTVGYLEA TQQPLVEQKG QLNDILVRLP NALKIIGRAG       300
     GVYGDFFNFY ACDVTLKLNG LQPGGPVRTV KVWGQPTGRC TPQ                         343
//

If you have problems or comments...

PBIL Back to PBIL home page