(data stored in ACNUC30630 zone)

EMBL: CP000580.PE114

CP000580.PE114       Location/Qualifiers
FT   CDS             123952..124623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0114"
FT                   /product="putative conserved MCE associated membrane
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0124 putative conserved MCE
FT                   associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95927"
FT                   /protein_id="ABN95927.1"
FT                   /translation="MEGDAGTRQLNPTDAEETPDKSVAVSGDNPDDTESPAEDGILGER
FT                   VTTVPSEDDGRRPPRLGRGWLTAICAVLLLLGAGAGVGGYLALRSHEESTQLAENEAAA
FT                   VAAARDCVAATHAPDAAAMTESQAKILECSTGDFGVQAGLYGGLLVDAYRAANVQVQVS
FT                   DMRAAVEKHNADGSIDVLVAVRVKVTNSEAADQEQGYRLRVQMAPDEGTYKVARLDQVT
FT                   S"
     MEGDAGTRQL NPTDAEETPD KSVAVSGDNP DDTESPAEDG ILGERVTTVP SEDDGRRPPR        60
     LGRGWLTAIC AVLLLLGAGA GVGGYLALRS HEESTQLAEN EAAAVAAARD CVAATHAPDA       120
     AAMTESQAKI LECSTGDFGV QAGLYGGLLV DAYRAANVQV QVSDMRAAVE KHNADGSIDV       180
     LVAVRVKVTN SEAADQEQGY RLRVQMAPDE GTYKVARLDQ VTS                         223
//

If you have problems or comments...

PBIL Back to PBIL home page