(data stored in ACNUC30630 zone)

EMBL: CP000580.PE119

CP000580.PE119       Location/Qualifiers
FT   CDS             127741..128511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0119"
FT                   /product="fructosamine kinase"
FT                   /note="PFAM: fructosamine kinase; KEGG: mmc:Mmcs_0129
FT                   fructosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95932"
FT                   /protein_id="ABN95932.1"
FT                   /translation="MTEFVKRNPDAPPGFFACEAAGLRWLAAAGGAACVPVIDCDATSL
FT                   TLEHLDSAAPSRSAAAAFGARLAVTHDAGASGFGAGPDGWGGPGFFGPLQKPLPMSLTA
FT                   HPTWGEFYADERLGPMGEHAAPRLTAAGREALAAVRDLCRAGRFDDGDPPARLHGDLWS
FT                   GNLMWTPDGVVLIDPAAHGGHRETDLAMLALFGCPHFDEVIAGYQSVRPLRGGWRERIA
FT                   LHQLYPLLAHVVLFGGGYIRQTESALRSVLSDFA"
     MTEFVKRNPD APPGFFACEA AGLRWLAAAG GAACVPVIDC DATSLTLEHL DSAAPSRSAA        60
     AAFGARLAVT HDAGASGFGA GPDGWGGPGF FGPLQKPLPM SLTAHPTWGE FYADERLGPM       120
     GEHAAPRLTA AGREALAAVR DLCRAGRFDD GDPPARLHGD LWSGNLMWTP DGVVLIDPAA       180
     HGGHRETDLA MLALFGCPHF DEVIAGYQSV RPLRGGWRER IALHQLYPLL AHVVLFGGGY       240
     IRQTESALRS VLSDFA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page