(data stored in ACNUC30630 zone)

EMBL: CP000580.PE120

CP000580.PE120       Location/Qualifiers
FT   CDS             128884..131172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0120"
FT                   /product="AAA ATPase containing von Willebrand factor type
FT                   A (vWA) domain-like protein"
FT                   /note="KEGG: mmc:Mmcs_0130 AAA ATPase containing von
FT                   Willebrand factor type A (vWA) domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95933"
FT                   /protein_id="ABN95933.1"
FT                   /translation="MAKHRGAKRRSKKIAALGAVTVTATALTVGAAPAPQASAAAARST
FT                   DRVDLTADFRLFPPPQAIPDLTGGAGEAAYDLKNEFADFVFRSIFENLNLAAFAQAAGV
FT                   DPQSILERVLDNLPLALLTDPIFVDLLGGITLPLAAALGALPVLNQIPLLRDLLTQGLN
FT                   VAGLNTISGLLDILGLDLSNLADLTGLGERVGVNLVTSGDVFTLLKVLGTDLGWVPTLP
FT                   NSVADDVNETEYLGIGVDGVLDLVDTGIINVPGLLNQLLDLLNLNTDQIPDVLKVRAPV
FT                   VIGEGVGAFAAGMAYQDILAQLPNQPGGANYNGVEADPLLGSVTVLPMLLLRNPGRANG
FT                   GLFARLYPLAGLFGIDTVTPDTEVSNSGGVRLPGGLYVGGATLIPVKIDVTLQHDWLSD
FT                   VPAWPNPFSLLNTLTAVVAPTYILRGLDTGLVAGAVAGQLGPQIGEVVGGIAEDDPLAL
FT                   DFYVTVPIDALPLLEPTYLFFDAINLLTGANLNNPIGTALGPALSSLVNLGYTDVVRQW
FT                   NDDGDYWEYVRTFDDTDVPTAFGSFPDINWMNVPGDIAGAFAAGVRQAFEDGLVNRDGP
FT                   VKNALATLLNLIGLDNGLPGGIGGAGLNGVLDQIRDTIDDVLGGLDLPRPSTAAVNSVP
FT                   DDASPRIALRTVGGEDTPAEEADDDTRDHVEDVPVADTDTDGDAETDTDIDTGTDTENE
FT                   PVDEPEDQLEEDETTDERETTVEDEDASEAEASEAEPADTEDTADTKDTGDTKDTGDTG
FT                   ESGAGEKAA"
     MAKHRGAKRR SKKIAALGAV TVTATALTVG AAPAPQASAA AARSTDRVDL TADFRLFPPP        60
     QAIPDLTGGA GEAAYDLKNE FADFVFRSIF ENLNLAAFAQ AAGVDPQSIL ERVLDNLPLA       120
     LLTDPIFVDL LGGITLPLAA ALGALPVLNQ IPLLRDLLTQ GLNVAGLNTI SGLLDILGLD       180
     LSNLADLTGL GERVGVNLVT SGDVFTLLKV LGTDLGWVPT LPNSVADDVN ETEYLGIGVD       240
     GVLDLVDTGI INVPGLLNQL LDLLNLNTDQ IPDVLKVRAP VVIGEGVGAF AAGMAYQDIL       300
     AQLPNQPGGA NYNGVEADPL LGSVTVLPML LLRNPGRANG GLFARLYPLA GLFGIDTVTP       360
     DTEVSNSGGV RLPGGLYVGG ATLIPVKIDV TLQHDWLSDV PAWPNPFSLL NTLTAVVAPT       420
     YILRGLDTGL VAGAVAGQLG PQIGEVVGGI AEDDPLALDF YVTVPIDALP LLEPTYLFFD       480
     AINLLTGANL NNPIGTALGP ALSSLVNLGY TDVVRQWNDD GDYWEYVRTF DDTDVPTAFG       540
     SFPDINWMNV PGDIAGAFAA GVRQAFEDGL VNRDGPVKNA LATLLNLIGL DNGLPGGIGG       600
     AGLNGVLDQI RDTIDDVLGG LDLPRPSTAA VNSVPDDASP RIALRTVGGE DTPAEEADDD       660
     TRDHVEDVPV ADTDTDGDAE TDTDIDTGTD TENEPVDEPE DQLEEDETTD ERETTVEDED       720
     ASEAEASEAE PADTEDTADT KDTGDTKDTG DTGESGAGEK AA                          762
//

If you have problems or comments...

PBIL Back to PBIL home page