(data stored in ACNUC30630 zone)

EMBL: CP000580.PE13

CP000580.PE13        Location/Qualifiers
FT   CDS             14272..15108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0013"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   mmc:Mmcs_0013 protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95826"
FT                   /protein_id="ABN95826.1"
FT                   /translation="MVQMPPEPNAVPDRETPPTTSAAPAAPARAGAGRRSGWRFGVPLV
FT                   CLAAGLLLAATHGVSGGDEIRRSDAPRLVDLVREAQQSVDRLGAERDTLSAQVDGHHGG
FT                   SPGTDAALSAITNRSAALAAEAGLNPVKGPGLVVTLNDAQRDAEGRFPRDASPDDLVVH
FT                   QQDIQAVLNALWSAGAEGVQMQDQRIIATSAPRCVGNTLLLNGRTYSPPYVITAIGDAG
FT                   AMQAALSASPLVTLYKQYVVRFGLGYTEEPRAEVELVGHTEPVRMKHAQPIGPVGY"
     MVQMPPEPNA VPDRETPPTT SAAPAAPARA GAGRRSGWRF GVPLVCLAAG LLLAATHGVS        60
     GGDEIRRSDA PRLVDLVREA QQSVDRLGAE RDTLSAQVDG HHGGSPGTDA ALSAITNRSA       120
     ALAAEAGLNP VKGPGLVVTL NDAQRDAEGR FPRDASPDDL VVHQQDIQAV LNALWSAGAE       180
     GVQMQDQRII ATSAPRCVGN TLLLNGRTYS PPYVITAIGD AGAMQAALSA SPLVTLYKQY       240
     VVRFGLGYTE EPRAEVELVG HTEPVRMKHA QPIGPVGY                               278
//

If you have problems or comments...

PBIL Back to PBIL home page