(data stored in ACNUC30630 zone)

EMBL: CP000580.PE141

CP000580.PE141       Location/Qualifiers
FT   CDS             149698..150684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0141"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mmc:Mmcs_0151 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95954"
FT                   /protein_id="ABN95954.1"
FT                   /translation="MPQQTMRKLTTAIFAAGLFGGLVLSAAPALAQPAPPPPPPVPVDP
FT                   IAPPPPPANPFAFPAPAAADPFAPTAQPLPIPEGTPAGQNPTPYVGKPVFAPPTFNPVN
FT                   GSIAGAAKPIYINFQRPIANRALAEQAIHISSNPPVPGRFYWTSDTQVRWRPQDFWPAG
FT                   TVVNIDASGTKSSFTVPEQLVATIDNKALQMEIHRNGELVKTFPVSMGKKGYDTKNGTY
FT                   YVLEKFADIVMDSSTYGVPVDDPSGEGYKLKVQDAVRIDNSGVFVHSAPWSVGSQGESN
FT                   VSHGCINLSPANAQWFFDNFGSGDAVVIKNSTGIYNQPDGASDWQMF"
     MPQQTMRKLT TAIFAAGLFG GLVLSAAPAL AQPAPPPPPP VPVDPIAPPP PPANPFAFPA        60
     PAAADPFAPT AQPLPIPEGT PAGQNPTPYV GKPVFAPPTF NPVNGSIAGA AKPIYINFQR       120
     PIANRALAEQ AIHISSNPPV PGRFYWTSDT QVRWRPQDFW PAGTVVNIDA SGTKSSFTVP       180
     EQLVATIDNK ALQMEIHRNG ELVKTFPVSM GKKGYDTKNG TYYVLEKFAD IVMDSSTYGV       240
     PVDDPSGEGY KLKVQDAVRI DNSGVFVHSA PWSVGSQGES NVSHGCINLS PANAQWFFDN       300
     FGSGDAVVIK NSTGIYNQPD GASDWQMF                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page