(data stored in ACNUC30630 zone)

EMBL: CP000580.PE143

CP000580.PE143       Location/Qualifiers
FT   CDS             151741..152226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95956"
FT                   /protein_id="ABN95956.1"
FT                   /translation="MTRAVAAAMLMLVAVEIYAVVRLDRDDVLTVSAVALAGALIAARF
FT                   ALRGEAAPASTATDADERGAALRRWVDRTETMIGWSEASRADWDRRLRPMLARQFELAT
FT                   GQRKARDARAFHATGQMLFGPELWQWVDPENVSRTGADEPGPGREALGEILRRLERV"
     MTRAVAAAML MLVAVEIYAV VRLDRDDVLT VSAVALAGAL IAARFALRGE AAPASTATDA        60
     DERGAALRRW VDRTETMIGW SEASRADWDR RLRPMLARQF ELATGQRKAR DARAFHATGQ       120
     MLFGPELWQW VDPENVSRTG ADEPGPGREA LGEILRRLER V                           161
//

If you have problems or comments...

PBIL Back to PBIL home page