(data stored in ACNUC30630 zone)

EMBL: CP000580.PE146

CP000580.PE146       Location/Qualifiers
FT   CDS             154422..154892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95959"
FT                   /protein_id="ABN95959.1"
FT                   /translation="MKALLPGVFGVLMVAAVVYRVDGPALVTAVAALVAVTVSVWWRPA
FT                   AVVAVVLTVSAVVLAPSAPMSTALAGLAAAAYLVLRHNDGHGEGRATPPTMVAAVAFAL
FT                   TATAVVALPVDIPWLPLAAPVALLVGYVLTLRPFSDFGVLGRAQHDPARRNP"
     MKALLPGVFG VLMVAAVVYR VDGPALVTAV AALVAVTVSV WWRPAAVVAV VLTVSAVVLA        60
     PSAPMSTALA GLAAAAYLVL RHNDGHGEGR ATPPTMVAAV AFALTATAVV ALPVDIPWLP       120
     LAAPVALLVG YVLTLRPFSD FGVLGRAQHD PARRNP                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page