(data stored in ACNUC30630 zone)

EMBL: CP000580.PE160

CP000580.PE160       Location/Qualifiers
FT   CDS             complement(168453..171722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0160"
FT                   /product="drug exporters of the RND superfamily-like
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0171 drug exporters of the RND
FT                   superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95973"
FT                   /protein_id="ABN95973.1"
FT                   /translation="MFAWWGRNVYRYRYIVIGVMVALCIGGGIYGISLGNNVTQSGFYD
FT                   EGSQSVQASVAGDEVYGRDRTSHVVAILTPPDGEKVDNPEWQREVVGELDALVKDHPDQ
FT                   VVSWVGWLRAPDAASETVQQMKTADLSKTFVSVPLKGDTDDEILKNYQVIEPDLQEIND
FT                   GNIQLAGLNPLASELTGSIGEDQKRAEVAAIPLVCVVLFFVFGGVIAAALPGLIGGLTI
FT                   AGALGIMRLLAEIMPVHFFAQPVVTLMGLGIAVDYGLFMVSRFREELAEGYDTEAAVRR
FT                   TVMTSGRTIMFSAVILVASSVPLLLFPQGFLKSITYAIIASVMLAAVLSITVLAAALAI
FT                   LGPRVDALGVKTLIKFAEPDPISSDPAVQKTNTFAIASIPLGLLVPPVGIALGHIARKR
FT                   IKQTGEQGANLALIGLVLGYTVLYGAMAYGVIALKDNGTIGSGVYWMLLGIVAFLVIVT
FT                   FGLALARYVPLARRPIVWWLHWLAEKTQKTKTRAEVEQGFWGKLVTHVMKRPGTFAFPI
FT                   IVVMILLIIPLGQLSLGGISEKYLPPDNSVRQAQEDFDRSFPGFRTEPLTIVLKSDNGD
FT                   PVTDQQVADIRAKAMSISGFIDPDNDPSKMWQERSVQEGGSEDPSVRVIQNGLENRNDA
FT                   ATKIEELRALSPPRGVSVWVGGTPALEQDSIHSLFDRLPLMVTILIVTTTILMFLAFGS
FT                   LVLPIKAALMSALTLGSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLIIAVIWGLST
FT                   DYEVFLVSRMVEARARGLSTAEAIRVGTATTGRLITGAALVLAVVAGAFVFSDLVMMKY
FT                   LAFGLLLALLLDATIIRMFLVPAIMKMLGDDCWWAPRWMKRLQERLGLGEVELPDERKR
FT                   PLVRDPAEDQALVGAGAPVPPRPRPPHDPTHPGVEGRVGPTRIPPGPPRLNGPSVAGTS
FT                   RIPTNRPAPGHEPPTTRLSMAKNAVRGAVNTATTPRAPRPTGPAPKREEREIESWLGEL
FT                   RGGPSNPGGGQPPRPPQPSAEPTTAMRAGAPKPEPEPEGNEPTTAIPVQRPPQPEESDA
FT                   TTKIPTQQDPKSTEKLNAPEEQKRRGGGMSAAELLRREGRM"
     MFAWWGRNVY RYRYIVIGVM VALCIGGGIY GISLGNNVTQ SGFYDEGSQS VQASVAGDEV        60
     YGRDRTSHVV AILTPPDGEK VDNPEWQREV VGELDALVKD HPDQVVSWVG WLRAPDAASE       120
     TVQQMKTADL SKTFVSVPLK GDTDDEILKN YQVIEPDLQE INDGNIQLAG LNPLASELTG       180
     SIGEDQKRAE VAAIPLVCVV LFFVFGGVIA AALPGLIGGL TIAGALGIMR LLAEIMPVHF       240
     FAQPVVTLMG LGIAVDYGLF MVSRFREELA EGYDTEAAVR RTVMTSGRTI MFSAVILVAS       300
     SVPLLLFPQG FLKSITYAII ASVMLAAVLS ITVLAAALAI LGPRVDALGV KTLIKFAEPD       360
     PISSDPAVQK TNTFAIASIP LGLLVPPVGI ALGHIARKRI KQTGEQGANL ALIGLVLGYT       420
     VLYGAMAYGV IALKDNGTIG SGVYWMLLGI VAFLVIVTFG LALARYVPLA RRPIVWWLHW       480
     LAEKTQKTKT RAEVEQGFWG KLVTHVMKRP GTFAFPIIVV MILLIIPLGQ LSLGGISEKY       540
     LPPDNSVRQA QEDFDRSFPG FRTEPLTIVL KSDNGDPVTD QQVADIRAKA MSISGFIDPD       600
     NDPSKMWQER SVQEGGSEDP SVRVIQNGLE NRNDAATKIE ELRALSPPRG VSVWVGGTPA       660
     LEQDSIHSLF DRLPLMVTIL IVTTTILMFL AFGSLVLPIK AALMSALTLG STMGILTWMF       720
     VDGHGSGLMN YTPQPLMAPM IGLIIAVIWG LSTDYEVFLV SRMVEARARG LSTAEAIRVG       780
     TATTGRLITG AALVLAVVAG AFVFSDLVMM KYLAFGLLLA LLLDATIIRM FLVPAIMKML       840
     GDDCWWAPRW MKRLQERLGL GEVELPDERK RPLVRDPAED QALVGAGAPV PPRPRPPHDP       900
     THPGVEGRVG PTRIPPGPPR LNGPSVAGTS RIPTNRPAPG HEPPTTRLSM AKNAVRGAVN       960
     TATTPRAPRP TGPAPKREER EIESWLGELR GGPSNPGGGQ PPRPPQPSAE PTTAMRAGAP      1020
     KPEPEPEGNE PTTAIPVQRP PQPEESDATT KIPTQQDPKS TEKLNAPEEQ KRRGGGMSAA      1080
     ELLRREGRM                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page