(data stored in ACNUC30630 zone)

EMBL: CP000580.PE163

CP000580.PE163       Location/Qualifiers
FT   CDS             173362..174372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95976"
FT                   /protein_id="ABN95976.1"
FT                   /translation="MPRFSRDPTRREGATIFVPDFDDVLTRFAQECGDAAVAAVAARLA
FT                   APLRVAVTGRAGVGRTTLARALARDGRRVAEHTPDVAVVVVAEAVKPEDVASVAGWCDA
FT                   DVPVVVVGNKADLTGPIPSDALRRYRSGEHGDVSVESVVALLAVVSLDDDALGALQLLA
FT                   AQPAELRSANAFLDAAHPLPRDVRTRLLRTLGLRGVAHSVRALRDGADPHDLPTLLREV
FT                   SGFDRVLDRLDALAAPARYDRIRAALAELQGRAAGDDRIAAFLADDDTVLAVMTAAVDV
FT                   VQAAGLAVDPGDDAATHLRRAVWWRGYSRGPVSPLHRACGADIARGSLRLFERRR"
     MPRFSRDPTR REGATIFVPD FDDVLTRFAQ ECGDAAVAAV AARLAAPLRV AVTGRAGVGR        60
     TTLARALARD GRRVAEHTPD VAVVVVAEAV KPEDVASVAG WCDADVPVVV VGNKADLTGP       120
     IPSDALRRYR SGEHGDVSVE SVVALLAVVS LDDDALGALQ LLAAQPAELR SANAFLDAAH       180
     PLPRDVRTRL LRTLGLRGVA HSVRALRDGA DPHDLPTLLR EVSGFDRVLD RLDALAAPAR       240
     YDRIRAALAE LQGRAAGDDR IAAFLADDDT VLAVMTAAVD VVQAAGLAVD PGDDAATHLR       300
     RAVWWRGYSR GPVSPLHRAC GADIARGSLR LFERRR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page