(data stored in ACNUC30630 zone)

EMBL: CP000580.PE164

CP000580.PE164       Location/Qualifiers
FT   CDS             174369..175862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95977"
FT                   /protein_id="ABN95977.1"
FT                   /translation="MSAASDPVAAADAVVAAVDPALDSPGVQSSDSVLVTGPWLAGVSS
FT                   LIAVLRDRLPEVSFVEADELPAGSAPVAVVFAVSAVSALAGSDCELLDLAADHTDCVIG
FT                   VVTKIDVHLDWREVMAADRELLGAHRRRYAALPWVGVAAAPDHGDPMVDDLVDLLRDTL
FT                   GDPAVLRRNRLRAWESQLEKVVARYRADGEGADRHARVSALRAQRDEIRRARRVEKSQR
FT                   AIALRSQIQQARVQLTYFARNRCASVRGELQEDIAELGRRRLDAFEQTVRGRAAEVMTE
FT                   VDEGVTTHLTAVAADLHLDDVPSPPQPIPVPDLPGPSLRSRRLETRLMMLLGAGFGLGV
FT                   ALAVSRLFSGVDPGLTVAGVLAGAAAGLAVAVWVVGIRGLLHDRGVLDRWVADVTATLR
FT                   SAAEEAVATRVLAAEAALTAALAAEEAADADAAAVRIAEIDAELREHAAATARAAALRD
FT                   RRLPGLQRALEAVCAELYDKKADEFTEANERNSGKNVGY"
     MSAASDPVAA ADAVVAAVDP ALDSPGVQSS DSVLVTGPWL AGVSSLIAVL RDRLPEVSFV        60
     EADELPAGSA PVAVVFAVSA VSALAGSDCE LLDLAADHTD CVIGVVTKID VHLDWREVMA       120
     ADRELLGAHR RRYAALPWVG VAAAPDHGDP MVDDLVDLLR DTLGDPAVLR RNRLRAWESQ       180
     LEKVVARYRA DGEGADRHAR VSALRAQRDE IRRARRVEKS QRAIALRSQI QQARVQLTYF       240
     ARNRCASVRG ELQEDIAELG RRRLDAFEQT VRGRAAEVMT EVDEGVTTHL TAVAADLHLD       300
     DVPSPPQPIP VPDLPGPSLR SRRLETRLMM LLGAGFGLGV ALAVSRLFSG VDPGLTVAGV       360
     LAGAAAGLAV AVWVVGIRGL LHDRGVLDRW VADVTATLRS AAEEAVATRV LAAEAALTAA       420
     LAAEEAADAD AAAVRIAEID AELREHAAAT ARAAALRDRR LPGLQRALEA VCAELYDKKA       480
     DEFTEANERN SGKNVGY                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page