(data stored in ACNUC30630 zone)

EMBL: CP000580.PE19

CP000580.PE19        Location/Qualifiers
FT   CDS             complement(21899..23374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0019"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   mmc:Mmcs_0019 protein serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95832"
FT                   /protein_id="ABN95832.1"
FT                   /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLSKLDNAVREGNSAIAAHVEADPELEGMGTTLTAILFA
FT                   GNRLGLVHIGDSRGYLMRDGELTQITKDDTFVQTLVDEGRITAEEAHSHPQRSLIMRAL
FT                   TGHEVEPTLIMREARAGDRYLLCSDGLSDPVSHDTIAEAMQIPDVAESADRLIELALRG
FT                   GGPDNVTVVVADVVDYDYGQTAPILAGAVSGDDDQPPPNTAAGRASAFNPKRNAPKRVV
FT                   AQPEEPVKKPRSKRRMIIAATLVVLVVLAGLAIAREIVRNNYYVTAHEGTVSIMRGVDG
FT                   SLLGYSLQEPYLLGCLNARNELSLISAGQSGENRGCQLLDVQDMRESERAQVVAGLPGG
FT                   SLDEAIAQIEELARSSVLPICPPPATTSRRPPPPPPPSPTESAATSAVPRPGTSPAPET
FT                   PTTVTPPPPPPSPTVTALPPPPPQPGTTCRAAS"
     MTLVLRYAAR SDRGLVRANN EDSVYAGARL LALADGMGGH AAGEVASQLV IAALAHLDDD        60
     EPGGDLLSKL DNAVREGNSA IAAHVEADPE LEGMGTTLTA ILFAGNRLGL VHIGDSRGYL       120
     MRDGELTQIT KDDTFVQTLV DEGRITAEEA HSHPQRSLIM RALTGHEVEP TLIMREARAG       180
     DRYLLCSDGL SDPVSHDTIA EAMQIPDVAE SADRLIELAL RGGGPDNVTV VVADVVDYDY       240
     GQTAPILAGA VSGDDDQPPP NTAAGRASAF NPKRNAPKRV VAQPEEPVKK PRSKRRMIIA       300
     ATLVVLVVLA GLAIAREIVR NNYYVTAHEG TVSIMRGVDG SLLGYSLQEP YLLGCLNARN       360
     ELSLISAGQS GENRGCQLLD VQDMRESERA QVVAGLPGGS LDEAIAQIEE LARSSVLPIC       420
     PPPATTSRRP PPPPPPSPTE SAATSAVPRP GTSPAPETPT TVTPPPPPPS PTVTALPPPP       480
     PQPGTTCRAA S                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page