(data stored in ACNUC30630 zone)

EMBL: CP000580.PE210

CP000580.PE210       Location/Qualifiers
FT   CDS             complement(222419..224014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96023"
FT                   /protein_id="ABN96023.1"
FT                   /translation="MTAPLLPPGYLLLRDAVSTPRSYLTDAALGLSEAAPRALPQDFAI
FT                   ALASHVLDGGVVVKVLLVAGLWAAGWGAARLASTVVPDAGVAGQCVAVTVAVWNPYVAE
FT                   RLLQGHWSLLVGYGCLPWVAAAVLRLRDGSGPWWPLPFWIAVAGLTPTGLLLAAVVAVV
FT                   SVCAPGAGRRRIAVLGAALGAAVVSALPWLVAAAVSGSLAVSPAAGLPAFAARAEPGLG
FT                   TLGSLAGLGGIWNADAVPGSRTTLFAVVATVVLLAVVLAGAWVVRHRPAARPLLILAAA
FT                   AVLFPAVMATGPGLAVLEHTVRALPGLGVLRDGQKWVALAVPGYAVAGAGAVLAVRRVS
FT                   PAALGAVCCAALIAVLPDLAFGVGGQMRAVQYPPGWAAAAAVINADPRPVAVLPPDSMR
FT                   QFAWAGEAPVLDPLPRWVRAEVLSTGDLVIGGTTVPGEGVRARAVQDLVMRGAPVSELA
FT                   DAGVGWVVVESGSAALDLPVAYRDDDLAVYRVGGDRPRSADRGLLIGAHVAWLAVLVGS
FT                   LVAGVVGLRRWPVA"
     MTAPLLPPGY LLLRDAVSTP RSYLTDAALG LSEAAPRALP QDFAIALASH VLDGGVVVKV        60
     LLVAGLWAAG WGAARLASTV VPDAGVAGQC VAVTVAVWNP YVAERLLQGH WSLLVGYGCL       120
     PWVAAAVLRL RDGSGPWWPL PFWIAVAGLT PTGLLLAAVV AVVSVCAPGA GRRRIAVLGA       180
     ALGAAVVSAL PWLVAAAVSG SLAVSPAAGL PAFAARAEPG LGTLGSLAGL GGIWNADAVP       240
     GSRTTLFAVV ATVVLLAVVL AGAWVVRHRP AARPLLILAA AAVLFPAVMA TGPGLAVLEH       300
     TVRALPGLGV LRDGQKWVAL AVPGYAVAGA GAVLAVRRVS PAALGAVCCA ALIAVLPDLA       360
     FGVGGQMRAV QYPPGWAAAA AVINADPRPV AVLPPDSMRQ FAWAGEAPVL DPLPRWVRAE       420
     VLSTGDLVIG GTTVPGEGVR ARAVQDLVMR GAPVSELADA GVGWVVVESG SAALDLPVAY       480
     RDDDLAVYRV GGDRPRSADR GLLIGAHVAW LAVLVGSLVA GVVGLRRWPV A                531
//

If you have problems or comments...

PBIL Back to PBIL home page