(data stored in ACNUC30630 zone)

EMBL: CP000580.PE216

CP000580.PE216       Location/Qualifiers
FT   CDS             complement(230666..234820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0216"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0226 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96029"
FT                   /protein_id="ABN96029.1"
FT                   /translation="MAALVLTFAQSPGQISPDTKLDLTANPLRFLARAANLWNSELPFG
FT                   QAQNQAYGYLFPHGTFFLAGDLLGLPGWVTQRLWWALLLTVGFWGVVRVAEALGLGSPT
FT                   SRVIGAVAYALSPRVLTTLGALSSETLPMMLAPWVLLPVILALRGEGSVRRLAARSAGA
FT                   IALMGAVNAVATLTGCLAAVLWWACHRPNRLWWRFTAWWFGCAALAVLWWVVPLLLLGR
FT                   ISPPFLDFIESSGVTTQWMSLTEMLRGTGSWTPFVAPTATAGSTLVTGSLAVLATTLVA
FT                   AAGMAGLALRSMPARGRLITMLLVGVALLAAGYAGGLGSPFADAVQAFLDGDGTPLRNL
FT                   QKLDPVLRLPLALGVIHLLARIPLPGSAPRPVWLHAFAHPEKDRRVAVGIVVLAALTAA
FT                   TSLAWTGRLTPPGAFTAIPGYWHETAAWLDAHNTGDPTAGRVLVAPGAPFATQVWGSSH
FT                   DEPLQVLGESPWGVRDSIPLTPPETIRALDSVQRLFAAGRPSAGLADTLARQGISYVVV
FT                   RNDLDPESSRSARPVLVHRAIDGSPGLTRVAQFGDPVGPGTLEGFVSDSGLRPRYPAVE
FT                   IYRVDAQHNPSTPYLVDAEAMARVDGAPEALLRLDERRRLLDRPPLGPMLLTADAERAG
FT                   LPAPLVTVTDTPTARETDYGRVDDHSSAIRTPDDPRNTFNRVPDYPSAGADVVYGRWTG
FT                   GRLSVSSSAADSTALPHVAPATGPTAAIDADTSTSWVSNALQAALGQWLQVDFDKPVTN
FT                   ATITVTPSATAVGAQVRRMEVATVNGTSTLRFEEAGKPLTVALPYGETPWVRITATGTD
FT                   DGSAGVQFGITDLSVTQYDANGFATPIQLRHTVEVPGPPAGSAVGLWDLGSELLGRQGC
FT                   VDSPDGVKCAAAMALSPEEPVNLSRTLAVPAPTSVQPTLWVRARQGPRLAELIRQPDTT
FT                   VVAGDADALDVLGSSYAAGDGDPRTAWTAPQRVVQHRTPPTLTLRLPAPTEVAALRITP
FT                   SKTEPPAHPRMVAVDLGNGPQARRLSGDGDTETIRLTPHRTDTIAVSLLDWNDIIDRTS
FT                   LGFDQLKPPGLAEVTALDRRGDPIGAADAGENRGRTVDVPCGAGPIIGVAGQFVPTRVT
FT                   ATVGALLDGAPVLARPCRTEPIALPAGQQELLVSPGATFVVDGVQLAAPAARDITPAPT
FT                   TPADTGAWGPDRREVRVVPGQRDRVLVVPESVNPGWQARGSGGDLLTPVVVNGWQQGWV
FT                   VPADTEGAVTLSFRSNTLYRAGLIGGLALLPLLALLVWLPARRRRDDEPAHPWRVPAVA
FT                   AAGGVLAVGAVISGWAGVVVVGGVLGVRYLLRNRSRLLDRFTLGVTAGGLTLAGAVLSQ
FT                   HPWRSVDGYVGFEPGVQLLALVSVAALAASAVPVNARSAPR"
     MAALVLTFAQ SPGQISPDTK LDLTANPLRF LARAANLWNS ELPFGQAQNQ AYGYLFPHGT        60
     FFLAGDLLGL PGWVTQRLWW ALLLTVGFWG VVRVAEALGL GSPTSRVIGA VAYALSPRVL       120
     TTLGALSSET LPMMLAPWVL LPVILALRGE GSVRRLAARS AGAIALMGAV NAVATLTGCL       180
     AAVLWWACHR PNRLWWRFTA WWFGCAALAV LWWVVPLLLL GRISPPFLDF IESSGVTTQW       240
     MSLTEMLRGT GSWTPFVAPT ATAGSTLVTG SLAVLATTLV AAAGMAGLAL RSMPARGRLI       300
     TMLLVGVALL AAGYAGGLGS PFADAVQAFL DGDGTPLRNL QKLDPVLRLP LALGVIHLLA       360
     RIPLPGSAPR PVWLHAFAHP EKDRRVAVGI VVLAALTAAT SLAWTGRLTP PGAFTAIPGY       420
     WHETAAWLDA HNTGDPTAGR VLVAPGAPFA TQVWGSSHDE PLQVLGESPW GVRDSIPLTP       480
     PETIRALDSV QRLFAAGRPS AGLADTLARQ GISYVVVRND LDPESSRSAR PVLVHRAIDG       540
     SPGLTRVAQF GDPVGPGTLE GFVSDSGLRP RYPAVEIYRV DAQHNPSTPY LVDAEAMARV       600
     DGAPEALLRL DERRRLLDRP PLGPMLLTAD AERAGLPAPL VTVTDTPTAR ETDYGRVDDH       660
     SSAIRTPDDP RNTFNRVPDY PSAGADVVYG RWTGGRLSVS SSAADSTALP HVAPATGPTA       720
     AIDADTSTSW VSNALQAALG QWLQVDFDKP VTNATITVTP SATAVGAQVR RMEVATVNGT       780
     STLRFEEAGK PLTVALPYGE TPWVRITATG TDDGSAGVQF GITDLSVTQY DANGFATPIQ       840
     LRHTVEVPGP PAGSAVGLWD LGSELLGRQG CVDSPDGVKC AAAMALSPEE PVNLSRTLAV       900
     PAPTSVQPTL WVRARQGPRL AELIRQPDTT VVAGDADALD VLGSSYAAGD GDPRTAWTAP       960
     QRVVQHRTPP TLTLRLPAPT EVAALRITPS KTEPPAHPRM VAVDLGNGPQ ARRLSGDGDT      1020
     ETIRLTPHRT DTIAVSLLDW NDIIDRTSLG FDQLKPPGLA EVTALDRRGD PIGAADAGEN      1080
     RGRTVDVPCG AGPIIGVAGQ FVPTRVTATV GALLDGAPVL ARPCRTEPIA LPAGQQELLV      1140
     SPGATFVVDG VQLAAPAARD ITPAPTTPAD TGAWGPDRRE VRVVPGQRDR VLVVPESVNP      1200
     GWQARGSGGD LLTPVVVNGW QQGWVVPADT EGAVTLSFRS NTLYRAGLIG GLALLPLLAL      1260
     LVWLPARRRR DDEPAHPWRV PAVAAAGGVL AVGAVISGWA GVVVVGGVLG VRYLLRNRSR      1320
     LLDRFTLGVT AGGLTLAGAV LSQHPWRSVD GYVGFEPGVQ LLALVSVAAL AASAVPVNAR      1380
     SAPR                                                                   1384
//

If you have problems or comments...

PBIL Back to PBIL home page