(data stored in ACNUC30630 zone)

EMBL: CP000580.PE217

CP000580.PE217       Location/Qualifiers
FT   CDS             complement(234912..235085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0217"
FT                   /product="small secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0227 small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96030"
FT                   /protein_id="ABN96030.1"
FT                   /translation="MDRFIVPAAASIVVGLLLGAAAVFGVTLMVQEDSKPPLQAGDPAS
FT                   SVLNRVEYGDRS"
     MDRFIVPAAA SIVVGLLLGA AAVFGVTLMV QEDSKPPLQA GDPASSVLNR VEYGDRS           57
//

If you have problems or comments...

PBIL Back to PBIL home page