(data stored in ACNUC30630 zone)

EMBL: CP000580.PE218

CP000580.PE218       Location/Qualifiers
FT   CDS             complement(235111..235626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0218"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0228 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96031"
FT                   /protein_id="ABN96031.1"
FT                   /translation="MTAHADVSARESVSEVHRQVGQEIMVIAYDGTANARRAVHYAGRF
FT                   LSANRAVVLTVWSPTLRGSEPPAVDLDGPPDPAPDDEDIAYADAQRTNAEGIELARAAG
FT                   LSAEAMCVAATSTVWNTIIETADTLDADLIVTGTRGTTGLRSLLQSSVADRVLRHGHRP
FT                   VLIVPPGR"
     MTAHADVSAR ESVSEVHRQV GQEIMVIAYD GTANARRAVH YAGRFLSANR AVVLTVWSPT        60
     LRGSEPPAVD LDGPPDPAPD DEDIAYADAQ RTNAEGIELA RAAGLSAEAM CVAATSTVWN       120
     TIIETADTLD ADLIVTGTRG TTGLRSLLQS SVADRVLRHG HRPVLIVPPG R                171
//

If you have problems or comments...

PBIL Back to PBIL home page