(data stored in ACNUC30630 zone)

EMBL: CP000580.PE219

CP000580.PE219       Location/Qualifiers
FT   CDS             235699..236892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0219"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: mmc:Mmcs_0229 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96032"
FT                   /protein_id="ABN96032.1"
FT                   /translation="MAWTRGLCALVATSGMLLACSSPKQEPAAAPADPAITAAPVSAAP
FT                   AVPLKAPVPLAPGAAACGQGAALLSEMTTRDKLAQLLMVGVTGAADARAVVDNHRIGGI
FT                   MIGSWTDLSMMGAPLAEIAASAGPLPLAVSVDEEGGRVSRLASLIGSQPSARALAQSST
FT                   PDQVYGIALERGRAMRGLGVTIDFAPVVDVTGASAAIGDRSFGDDPATVTEYAGAYARG
FT                   LRDAGVLPVLKHFPGHGNASGDSHTEGVVTPPLSELQNSDLVPYRTLTAQAPVGVMVGH
FT                   MQVPGLTESDPASLSPAAYQLLRSGGYGGPGFNGPVFTDDISSMRAITDRYGVADAALR
FT                   ALQAGADTALWVTTAEVPAVLDRLEQAVGSGELTMPRVDQSVLRVAAMKGPNPRCGG"
     MAWTRGLCAL VATSGMLLAC SSPKQEPAAA PADPAITAAP VSAAPAVPLK APVPLAPGAA        60
     ACGQGAALLS EMTTRDKLAQ LLMVGVTGAA DARAVVDNHR IGGIMIGSWT DLSMMGAPLA       120
     EIAASAGPLP LAVSVDEEGG RVSRLASLIG SQPSARALAQ SSTPDQVYGI ALERGRAMRG       180
     LGVTIDFAPV VDVTGASAAI GDRSFGDDPA TVTEYAGAYA RGLRDAGVLP VLKHFPGHGN       240
     ASGDSHTEGV VTPPLSELQN SDLVPYRTLT AQAPVGVMVG HMQVPGLTES DPASLSPAAY       300
     QLLRSGGYGG PGFNGPVFTD DISSMRAITD RYGVADAALR ALQAGADTAL WVTTAEVPAV       360
     LDRLEQAVGS GELTMPRVDQ SVLRVAAMKG PNPRCGG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page