(data stored in ACNUC30630 zone)

EMBL: CP000580.PE232

CP000580.PE232       Location/Qualifiers
FT   CDS             complement(250569..252404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0232"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0242 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96045"
FT                   /protein_id="ABN96045.1"
FT                   /translation="MSHYKSNVRDQVFNLFEVLGVDKAMGQGDFSELDADTAREMLDEM
FT                   ARLAEGPIAESFFEGDRNPPVFDPKTHSVKLPEPFKKSMRALFDAGWDKAGMPEELGGM
FT                   PMPRALQWALIEHVLGANPAAYMYAMGGGMAHILHNLGTEEQKKWAVLAAERGWGATMV
FT                   LTEPDAGSDVGAGRTKAVKQDDGSWHIDGVKRFITSADSDDLFENIFHLVLARPEGAGP
FT                   GTKGLSLFFVPKFLVDFETGELGERNGAFVTNVEHKMGLKVSATCELSLGQHGVPAKGW
FT                   LVGEVHNGIAQMFDVIEQARMMVGTKAIATLSTGYLNALEYAKSRVQGADMTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKSYAEGLRALYLYTATFQDTAVAKAVHDVDSELAVRVNDLM
FT                   LPIVKGVGSEQAYAKLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGQALAYVAGQIEQFVKSESGNGRLKAERALLATALEDVQAMAASLTGYLMA
FT                   AQENPAELYKVGLGSVRFLMSVGDLVIGWLLQQQAAVAIGALDGGATGEDKAFYEGKVA
FT                   VASFFAKNFLPLLTSTRQVVEHLDNEIMELDEAAF"
     MSHYKSNVRD QVFNLFEVLG VDKAMGQGDF SELDADTARE MLDEMARLAE GPIAESFFEG        60
     DRNPPVFDPK THSVKLPEPF KKSMRALFDA GWDKAGMPEE LGGMPMPRAL QWALIEHVLG       120
     ANPAAYMYAM GGGMAHILHN LGTEEQKKWA VLAAERGWGA TMVLTEPDAG SDVGAGRTKA       180
     VKQDDGSWHI DGVKRFITSA DSDDLFENIF HLVLARPEGA GPGTKGLSLF FVPKFLVDFE       240
     TGELGERNGA FVTNVEHKMG LKVSATCELS LGQHGVPAKG WLVGEVHNGI AQMFDVIEQA       300
     RMMVGTKAIA TLSTGYLNAL EYAKSRVQGA DMTQMTDKTA PRVTITHHPD VRRSLMTQKS       360
     YAEGLRALYL YTATFQDTAV AKAVHDVDSE LAVRVNDLML PIVKGVGSEQ AYAKLTESLQ       420
     TFGGSGFLQD YPIEQYIRDA KIDSLYEGTT AIQAQDFFFR KIVRDKGQAL AYVAGQIEQF       480
     VKSESGNGRL KAERALLATA LEDVQAMAAS LTGYLMAAQE NPAELYKVGL GSVRFLMSVG       540
     DLVIGWLLQQ QAAVAIGALD GGATGEDKAF YEGKVAVASF FAKNFLPLLT STRQVVEHLD       600
     NEIMELDEAA F                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page