(data stored in ACNUC30630 zone)

EMBL: CP000580.PE239

CP000580.PE239       Location/Qualifiers
FT   CDS             complement(275658..276326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96052"
FT                   /protein_id="ABN96052.1"
FT                   /translation="MWIPLLVMAVAVSLEPFRVGMTVLMINRPQPRRQLLALLAGGFAM
FT                   GLTVGVIVLFVLRPALDSAHFTLPVVQIAVGAVVLVNAALVATGVWGRGRDAVSLADTR
FT                   FGPLATRTRRLLDGRSLWTAGIAGLGIALPSVDYLAALALIVASGAATTVQLGALMVFN
FT                   VVAFALVEIPLLCYLVAPERTRAALSALYEWLRAQGRRGVGALLAVIGCVLLGVGFAGL
FT                   "
     MWIPLLVMAV AVSLEPFRVG MTVLMINRPQ PRRQLLALLA GGFAMGLTVG VIVLFVLRPA        60
     LDSAHFTLPV VQIAVGAVVL VNAALVATGV WGRGRDAVSL ADTRFGPLAT RTRRLLDGRS       120
     LWTAGIAGLG IALPSVDYLA ALALIVASGA ATTVQLGALM VFNVVAFALV EIPLLCYLVA       180
     PERTRAALSA LYEWLRAQGR RGVGALLAVI GCVLLGVGFA GL                          222
//

If you have problems or comments...

PBIL Back to PBIL home page