(data stored in ACNUC30630 zone)

EMBL: CP000580.PE24

CP000580.PE24        Location/Qualifiers
FT   CDS             27429..28034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0024"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0034
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95837"
FT                   /protein_id="ABN95837.1"
FT                   /translation="MAGRPERAGVTNASINTGRRQRLDAQRNVLSILEAAKTTFADSGV
FT                   DVPARTITDLAGVGVGTLYRHFPRRSDLILAVIEREIDDCIEAAHELTARMEPRDALVA
FT                   WVSRFAEFVRTKHGLANALHSGDPAYTGLADTLLDRLEPVLDSLLERVPLNVRNRDTVS
FT                   ARDVLTTIALMCQPVPGETSSFNERMTKIFLEGLLASG"
     MAGRPERAGV TNASINTGRR QRLDAQRNVL SILEAAKTTF ADSGVDVPAR TITDLAGVGV        60
     GTLYRHFPRR SDLILAVIER EIDDCIEAAH ELTARMEPRD ALVAWVSRFA EFVRTKHGLA       120
     NALHSGDPAY TGLADTLLDR LEPVLDSLLE RVPLNVRNRD TVSARDVLTT IALMCQPVPG       180
     ETSSFNERMT KIFLEGLLAS G                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page