(data stored in ACNUC30630 zone)

EMBL: CP000580.PE249

CP000580.PE249       Location/Qualifiers
FT   CDS             285307..285678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0249"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: mmc:Mmcs_0259 nitrite reductase (NAD(P)H) large
FT                   subunit, NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96062"
FT                   /protein_id="ABN96062.1"
FT                   /translation="MTLLDDRNELNGPPDTRWTVACRYDYLIPCRGVGVLLPDGAQAAL
FT                   FRLDDGSLHAIGNIDPFSGAAVMSRGITGDRGGRAIVQSPIKKQAFAFDDGSCLDDPSV
FT                   SLPVYRTRRTADGIVEIEG"
     MTLLDDRNEL NGPPDTRWTV ACRYDYLIPC RGVGVLLPDG AQAALFRLDD GSLHAIGNID        60
     PFSGAAVMSR GITGDRGGRA IVQSPIKKQA FAFDDGSCLD DPSVSLPVYR TRRTADGIVE       120
     IEG                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page