(data stored in ACNUC30630 zone)

EMBL: CP000580.PE25

CP000580.PE25        Location/Qualifiers
FT   CDS             28178..29167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95838"
FT                   /protein_id="ABN95838.1"
FT                   /translation="MSENLCVKAPFSDLRYLVDCLGPLTRRDSGPCSLVRRRRHEAISL
FT                   SVPVARMGQRSEWGLGMGSKRSSDGSGAIGGAIFFVIVLIAMVPKPVWIAIGIGVAVIV
FT                   LGWVAYRIFEAVEKSRAEAAERERAEQAARAAAAKREREERARTEKQRRIDTLGKANAA
FT                   LVESALRAVKQIAGSEAARAGWLGDVDFTADIRGITENFQKAHALRGVAGKLSALDKPS
FT                   AEDRVILAEAKTTAANLERTAIERVELVGKCAVEAQLIDKSLRTEREDARVAEQRAELH
FT                   AKLSAMLYGIEAAPNTTPEDSAVDAVMARVQAYREIKYQIEQARDGQS"
     MSENLCVKAP FSDLRYLVDC LGPLTRRDSG PCSLVRRRRH EAISLSVPVA RMGQRSEWGL        60
     GMGSKRSSDG SGAIGGAIFF VIVLIAMVPK PVWIAIGIGV AVIVLGWVAY RIFEAVEKSR       120
     AEAAERERAE QAARAAAAKR EREERARTEK QRRIDTLGKA NAALVESALR AVKQIAGSEA       180
     ARAGWLGDVD FTADIRGITE NFQKAHALRG VAGKLSALDK PSAEDRVILA EAKTTAANLE       240
     RTAIERVELV GKCAVEAQLI DKSLRTERED ARVAEQRAEL HAKLSAMLYG IEAAPNTTPE       300
     DSAVDAVMAR VQAYREIKYQ IEQARDGQS                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page