(data stored in ACNUC30630 zone)

EMBL: CP000580.PE266

CP000580.PE266       Location/Qualifiers
FT   CDS             300306..301493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0266"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0275 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96079"
FT                   /protein_id="ABN96079.1"
FT                   /translation="MKSISARNVAGTLAVVCIAAIVALAVGLFNGSFTRSATVTVVSDR
FT                   VGLVMNPDTKVKLHGAQVGKVAAIEALPDGRAAIRLAMDPSQLAIIPSNVLVNVGSTTV
FT                   FGSKAVELVPPANPSPDPLRAGQVLDAGHVTVEINTVFEQLVSVLAKVEPAKLNETLGA
FT                   LSQGLAGRGEKFGRTLVDLDTLLADLDPSMDNLSRDIAVAPGVLNAYADAAPDLLATAD
FT                   NASRISDTLVERQSDLDALLVSAIGLAEVGNDVVATNRGAFTDVMRLLVPTTDLTNQYH
FT                   TALNCGLAGMLPLAMAPPPPVPGVLLLDSFVLGTERYRYPQNLPKVAARGGPQCVGLPD
FT                   VGYETRAPYVVSDIDANPAQYGNQGILLNSEGLKQMLFGPLDGPPRNTSQIGQPG"
     MKSISARNVA GTLAVVCIAA IVALAVGLFN GSFTRSATVT VVSDRVGLVM NPDTKVKLHG        60
     AQVGKVAAIE ALPDGRAAIR LAMDPSQLAI IPSNVLVNVG STTVFGSKAV ELVPPANPSP       120
     DPLRAGQVLD AGHVTVEINT VFEQLVSVLA KVEPAKLNET LGALSQGLAG RGEKFGRTLV       180
     DLDTLLADLD PSMDNLSRDI AVAPGVLNAY ADAAPDLLAT ADNASRISDT LVERQSDLDA       240
     LLVSAIGLAE VGNDVVATNR GAFTDVMRLL VPTTDLTNQY HTALNCGLAG MLPLAMAPPP       300
     PVPGVLLLDS FVLGTERYRY PQNLPKVAAR GGPQCVGLPD VGYETRAPYV VSDIDANPAQ       360
     YGNQGILLNS EGLKQMLFGP LDGPPRNTSQ IGQPG                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page