(data stored in ACNUC30630 zone)

EMBL: CP000580.PE276

CP000580.PE276       Location/Qualifiers
FT   CDS             309751..310239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96089"
FT                   /protein_id="ABN96089.1"
FT                   /translation="MRQARWRLILTVLIAAASVGLAVVLYVTQYRTDVQTDGAAASAAV
FT                   RAASEGTVALLSYQPDSVDTDLTAAKTHLTGEFLTYYGKFSDEILLPAARERAVRSEAA
FT                   VVRAAEAEIHPDAAKVLVYVNQTTTSRERPDASQTASSVMVSLTKVGERWLISAFDPI"
     MRQARWRLIL TVLIAAASVG LAVVLYVTQY RTDVQTDGAA ASAAVRAASE GTVALLSYQP        60
     DSVDTDLTAA KTHLTGEFLT YYGKFSDEIL LPAARERAVR SEAAVVRAAE AEIHPDAAKV       120
     LVYVNQTTTS RERPDASQTA SSVMVSLTKV GERWLISAFD PI                          162
//

If you have problems or comments...

PBIL Back to PBIL home page