(data stored in ACNUC30630 zone)

EMBL: CP000580.PE279

CP000580.PE279       Location/Qualifiers
FT   CDS             312460..313125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0279"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mmc:Mmcs_0288 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96092"
FT                   /protein_id="ABN96092.1"
FT                   /translation="MKSGDGPNVTATGWALLGVLSYQDELTGYDIKKWTEWSLRFFYGS
FT                   PAYSQIYTELKKLENIGLLTSRVETDGGARSKRLYKITKAGLDALRDWADEGPVDPPQL
FT                   KHNPLLRVTFGHLTNPRRLKEIMQDHVAYADRMQREAATEARWAEAEPAWAYGRVALQW
FT                   AERYYAAERELAQSVIKDLDAAEEAFAKSAESNQDGKPSLAKDYWYEIERRVRAEEGD"
     MKSGDGPNVT ATGWALLGVL SYQDELTGYD IKKWTEWSLR FFYGSPAYSQ IYTELKKLEN        60
     IGLLTSRVET DGGARSKRLY KITKAGLDAL RDWADEGPVD PPQLKHNPLL RVTFGHLTNP       120
     RRLKEIMQDH VAYADRMQRE AATEARWAEA EPAWAYGRVA LQWAERYYAA ERELAQSVIK       180
     DLDAAEEAFA KSAESNQDGK PSLAKDYWYE IERRVRAEEG D                           221
//

If you have problems or comments...

PBIL Back to PBIL home page