(data stored in ACNUC30630 zone)

EMBL: CP000580.PE3

CP000580.PE3         Location/Qualifiers
FT   CDS             3529..4422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: mmc:Mmcs_0003 6-phosphogluconate
FT                   dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95816"
FT                   /protein_id="ABN95816.1"
FT                   /translation="MQLGLVGLGKMGFNMRERLREGGHEVVGFDPRPEVTDVPSLAALA
FT                   DALAAPRVVWVMVPSGPVTHDTIVSLAEVLGEGDLVIDGGNSRFTEDAPHAELLKAKGI
FT                   GFIDAGVSGGVWGLAEGYGLMVGGDDADIERVMPIFDTLRPPGDRADGFVHAGPVGAGH
FT                   FAKMVHNGVEYALMTAYGEGYELLAAEELIRDPQAVYQAWTNGTVVRSWLQQLLAKALR
FT                   EDPGLAEISGYTEDSGEGRWTVEEAIRLRVPVPSIAASLFARFESRQEDSPTMKAVSAL
FT                   RNQFGGHAVQRISKSG"
     MQLGLVGLGK MGFNMRERLR EGGHEVVGFD PRPEVTDVPS LAALADALAA PRVVWVMVPS        60
     GPVTHDTIVS LAEVLGEGDL VIDGGNSRFT EDAPHAELLK AKGIGFIDAG VSGGVWGLAE       120
     GYGLMVGGDD ADIERVMPIF DTLRPPGDRA DGFVHAGPVG AGHFAKMVHN GVEYALMTAY       180
     GEGYELLAAE ELIRDPQAVY QAWTNGTVVR SWLQQLLAKA LREDPGLAEI SGYTEDSGEG       240
     RWTVEEAIRL RVPVPSIAAS LFARFESRQE DSPTMKAVSA LRNQFGGHAV QRISKSG          297
//

If you have problems or comments...

PBIL Back to PBIL home page