(data stored in ACNUC30630 zone)

EMBL: CP000580.PE301

CP000580.PE301       Location/Qualifiers
FT   CDS             334243..336126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0301"
FT                   /product="Cyclohexanone monooxygenase"
FT                   /EC_number="1.14.13.22"
FT                   /note="KEGG: mmc:Mmcs_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96114"
FT                   /protein_id="ABN96114.1"
FT                   /translation="MTTDAELRSHLRQADPGVLVAVLAQMTGDPSVIDEFAPAISHIPD
FT                   PPERAGVTDPDTMEALVDRIVEALDTPRSGGLAADDPNLFTRLLPVALGSDVEDEFVPL
FT                   LLEQGGFQLSQPTLPRDVPIPASTTVTIIGAGIAGIVAALAARDAGVAFEILDRNDEVG
FT                   GTWLTTKYPGIGVDTPSAYYSLSREVNPDWTNYYPQGAEYQAYLVSLADKHGLREHTRF
FT                   GTEVEALWWDDDRQEWQIHAVDRDGNRSVSHSRVVITAAGYLNRPRWPDIPGRDTFAGI
FT                   SVHSAQWDPSLDLTGKRVAIIGAGCTAVQIVDACVDQVEHLTVFQRQPHWVAPRKRLSD
FT                   DVPEYRRYLGRHLPYYANWHRLKSYWATADNNYPVIVRDPEWAERHLSISPANDVLLQM
FT                   CLEYIDRMFGEGTELAKKVTPDFAPYGKRIIRDPGGYYAALTRDHVDVEASEPAEVNAR
FT                   GIVTQDGRQIDLDVIVYATGYHLDFLSTVDIRGRGGRTLREEWGDSPRAYRGGTVPGFP
FT                   NLFITSAPNYSPGHGAGANFSMEVLAHYIMECLQLMASRRATTIEVTQEAYDDYVADID
FT                   DAMSRTVWCHTPNAHTYYRSGSGRVVVATPYRLIDVWQQHRAPVEDHFVIR"
     MTTDAELRSH LRQADPGVLV AVLAQMTGDP SVIDEFAPAI SHIPDPPERA GVTDPDTMEA        60
     LVDRIVEALD TPRSGGLAAD DPNLFTRLLP VALGSDVEDE FVPLLLEQGG FQLSQPTLPR       120
     DVPIPASTTV TIIGAGIAGI VAALAARDAG VAFEILDRND EVGGTWLTTK YPGIGVDTPS       180
     AYYSLSREVN PDWTNYYPQG AEYQAYLVSL ADKHGLREHT RFGTEVEALW WDDDRQEWQI       240
     HAVDRDGNRS VSHSRVVITA AGYLNRPRWP DIPGRDTFAG ISVHSAQWDP SLDLTGKRVA       300
     IIGAGCTAVQ IVDACVDQVE HLTVFQRQPH WVAPRKRLSD DVPEYRRYLG RHLPYYANWH       360
     RLKSYWATAD NNYPVIVRDP EWAERHLSIS PANDVLLQMC LEYIDRMFGE GTELAKKVTP       420
     DFAPYGKRII RDPGGYYAAL TRDHVDVEAS EPAEVNARGI VTQDGRQIDL DVIVYATGYH       480
     LDFLSTVDIR GRGGRTLREE WGDSPRAYRG GTVPGFPNLF ITSAPNYSPG HGAGANFSME       540
     VLAHYIMECL QLMASRRATT IEVTQEAYDD YVADIDDAMS RTVWCHTPNA HTYYRSGSGR       600
     VVVATPYRLI DVWQQHRAPV EDHFVIR                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page