(data stored in ACNUC30630 zone)

EMBL: CP000580.PE310

CP000580.PE310       Location/Qualifiers
FT   CDS             complement(343582..344601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0310"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mmc:Mmcs_0319 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96123"
FT                   /protein_id="ABN96123.1"
FT                   /translation="MIADVDSVQLIVTDVIEESHDARSLVFAEAAGLDYRPGQFLTLRV
FT                   PGTDGGAVARCYSLASSPHTDAAPKVTIKRVDGGYGSNWLCDNVVAGHVIESLPPSGTF
FT                   TPADLDRDLVLWAGGSGITPVMSILKSALAVGRGRVTLVYANRDERSVIFAAELRGLVT
FT                   RHPDRFTVAHWLESVQGLPGREQLAALARRFAGGEAYLCGPAPFMAAVQGALADAGVAR
FT                   DAVHTEVFRSLTGDPFAEVAPVDTATEDGADLRVDLDGRQHGLRWPRQSTLVDTMIAAG
FT                   LDVPYSCREGQCGSCAATLRSGRVDMPDTDILEPEDIEAGTILGCQATPASDDVHIEF"
     MIADVDSVQL IVTDVIEESH DARSLVFAEA AGLDYRPGQF LTLRVPGTDG GAVARCYSLA        60
     SSPHTDAAPK VTIKRVDGGY GSNWLCDNVV AGHVIESLPP SGTFTPADLD RDLVLWAGGS       120
     GITPVMSILK SALAVGRGRV TLVYANRDER SVIFAAELRG LVTRHPDRFT VAHWLESVQG       180
     LPGREQLAAL ARRFAGGEAY LCGPAPFMAA VQGALADAGV ARDAVHTEVF RSLTGDPFAE       240
     VAPVDTATED GADLRVDLDG RQHGLRWPRQ STLVDTMIAA GLDVPYSCRE GQCGSCAATL       300
     RSGRVDMPDT DILEPEDIEA GTILGCQATP ASDDVHIEF                              339
//

If you have problems or comments...

PBIL Back to PBIL home page