(data stored in ACNUC30630 zone)

EMBL: CP000580.PE312

CP000580.PE312       Location/Qualifiers
FT   CDS             complement(346405..347262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0312"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0323
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96125"
FT                   /protein_id="ABN96125.1"
FT                   /translation="MTATSDQLPLQELTTPSGTLRYYDTGAGPTVLFLHGSGPGVTGWR
FT                   NFRGVLPAFSAHFRCLILEFPGFGVSDDAGGHPMIDAQGAVAPFLDGLGVDRVDIVGNS
FT                   MGGGVGVNFAIHHPDRLRRLVTIGGIGTNVFSPGPSEGIRLLQEFTEDPTRQRLVDWLR
FT                   SMVYDEALVTEELIAERWELATDPETLAAARRMYGKAAFAQMMAFMRTSDAPLPWAQMH
FT                   KVAAPTLLTWGRDDRVSPLDMALIPMRTIPNAELHVFPNCGHWAMIEAKAAFEAAVLSF
FT                   LLRE"
     MTATSDQLPL QELTTPSGTL RYYDTGAGPT VLFLHGSGPG VTGWRNFRGV LPAFSAHFRC        60
     LILEFPGFGV SDDAGGHPMI DAQGAVAPFL DGLGVDRVDI VGNSMGGGVG VNFAIHHPDR       120
     LRRLVTIGGI GTNVFSPGPS EGIRLLQEFT EDPTRQRLVD WLRSMVYDEA LVTEELIAER       180
     WELATDPETL AAARRMYGKA AFAQMMAFMR TSDAPLPWAQ MHKVAAPTLL TWGRDDRVSP       240
     LDMALIPMRT IPNAELHVFP NCGHWAMIEA KAAFEAAVLS FLLRE                       285
//

If you have problems or comments...

PBIL Back to PBIL home page